DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd1a

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_991103.2 Gene:smyd1a ZFINID:ZDB-GENE-030131-9825 Length:485 Species:Danio rerio

Alignment Length:392 Identity:80/393 (20%)
Similarity:127/393 (32%) Gaps:166/393 (42%)


  Fly   220 TDP------GPRGRYMVAKEAISKGNVIFSERASCFVPLE--QLLICQQCAATLMSAPIPCPNC- 275
            |||      |.:||.:.....:|.|.|:|:|.:...|.|:  .|.:|..|....:: |..|..| 
Zfish     6 TDPVEVFGAGLKGRGLRGTRDLSAGEVVFAEASFAAVVLDSLSLQVCHSCFRRQVN-PHRCAQCK 69

  Fly   276 --HQRVVYCSRKCREAHSAIHKFECAAYR------KDILRLLGISHLALRL----------LLTY 322
              |    ||.|.|:.|....|:.||:|.|      .:.:||  ::.:..|:          .||.
Zfish    70 FAH----YCDRTCQRAAWDEHRKECSAIRNIGKAPNENVRL--VARILWRIQKHTGLVSDSQLTT 128

  Fly   323 IPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLL 387
            :..:..||..||                      ||.|:.|::                      
Zfish   129 LDMLEDHLSRMT----------------------PEDLKELKV---------------------- 149

  Fly   388 QLYLKEHTDFYDQFHSLPASI-EDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEF 446
                 :...||..:.....:: ||:   :|.|.    |.:..||..     |...:|:|:     
Zfish   150 -----DVKTFYTYWPKKSKAVGEDY---VSHLF----GVISCNGFTLSDQRGLQSVGIGL----- 197

  Fly   447 VMLQPELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV-NY----- 505
                                            .|.|.|.||.|.|:       |:|: |:     
Zfish   198 --------------------------------FPNLCLVNHDCWPN-------CTVILNHGDQSA 223

  Fly   506 --------------AAKDILEGEEIFNCYTMDYRN--SLKLQRSHPLKAIYKFECTCAKCTRTDP 554
                          |.:.|..|:|:    |:.|.:  |:...|...|:..|.|:|.|..|.....
Zfish   224 LDASFHSSRRIELRALEPISAGQEL----TVSYVDFLSVSTDRQRLLQQQYYFDCKCEHCVNGTK 284

  Fly   555 DQ 556
            |:
Zfish   285 DE 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/43 (30%)
SET <447..526 CDD:214614 16/99 (16%)
smyd1aNP_991103.2 zf-MYND 52..90 CDD:280009 13/43 (30%)
SET <203..252 CDD:279228 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56238984
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.