DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd4

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001096081.1 Gene:Smyd4 MGIID:2442796 Length:799 Species:Mus musculus

Alignment Length:872 Identity:194/873 (22%)
Similarity:310/873 (36%) Gaps:263/873 (30%)


  Fly    23 DEFETF--KSLASMPADILQIFQKLALDLLQD-------LEQPVDRKGCAERSKN---------- 68
            ||::::  |..||:|..:.....  ..:.|.|       |.||.|.....|.|.:          
Mouse     6 DEWKSYLLKKWASLPKSVQDTIS--TAETLSDIFLPSSSLLQPEDEMFLKELSSSYSVEKDNDAP 68

  Fly    69 --LREEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAY 131
              .|||||..|:|.       ....|..|||:.|..:....|::||.:|||..||...|.|....
Mouse    69 LFYREEGNRKFQEK-------EYTDAAVLYSKGVSHSRPNTEDISLCYANRSAALFHLGQYEACL 126

  Fly   132 DDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLKESFEQQL-----EDLK 191
            .|...|...||||||:.|:::|:..|   |..:..|:|....:..|:...:.:..|     :.|:
Mouse   127 KDIVEAGMHGYPERLQPKMMVRKTEC---LVNLGRLQEARQTISDLESSLTAKPTLVLSSYQILQ 188

  Fly   192 QKLELLKNQPREQETQGKVV---------DKSLGE-------------ILTDPGPRGRYMVAKEA 234
            :.::.||.:.:|:||..:.:         |.:|||             :.|.| .:||::||.:.
Mouse   189 RNVQHLKIKIQEKETLPEPIPAALTNAFEDIALGEENTQISGASLSVSLCTHP-LKGRHLVATKD 252

  Fly   235 ISKGNVIFSERA--SCFVPLEQL------------------LICQQCAATLMSAPIPCPNCHQRV 279
            |..|.::..|.|  |..:|.|..                  |.|.:|....: |.:||.:| ...
Mouse   253 ILPGELLVKEDAFVSVLIPGEMPRPHHCLENKWDTRVTSGDLYCHRCLKHTL-ATVPCGSC-SYA 315

  Fly   280 VYCSRKC-REAHSAIHKFECAAYRKDILRLLGI-SHLALRLLLTYIPYIRPHLQEMTSAKGMWEE 342
            .|||::| ::|....|..||:.  ..:|..||: .|:|||:.|.                ..:|:
Mouse   316 KYCSQECMQQAWDLYHSTECSL--GGLLLTLGVFCHVALRMTLL----------------ARFED 362

  Fly   343 IMNLSRKPEESENA-----PEYLRSLRMVSQLDQAIDEE-------------------LNYHILC 383
            :..:.|...:...:     ||....::......|...||                   .||:.:.
Mouse   363 VDRVVRMLCDEVGSTDTCLPESKNLVKAFDYTSQGESEEKSKIGEPPIPGCNVNGKYGSNYNAIF 427

  Fly   384 ANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVM 448
            :      |..||:.:...|....:|.     :|||    ..||.|     |::....::..:...
Mouse   428 S------LLPHTEKHSPEHRFICAIS-----VSAL----CRQLKA-----DSVQAQTLKSPKLKA 472

  Fly   449 LQPEL------WQKP--RHLKRGQ---------LHNLSHSDPIT---AINL-----PYLSLCNHA 488
            :.|.|      |...  ||:.:.|         .|..|:...||   .|.|     |.:||.||:
Mouse   473 VTPGLCADLTVWGAAMLRHMLQLQCNAQAITSICHTGSNESIITNSRQIRLATGIFPVVSLLNHS 537

  Fly   489 CEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTD 553
            |.|:....|.|......||:.|.:|:||.:||..........:|...|.:.|.|:|.|..     
Mouse   538 CRPNTSVSFTGTVATVRAAQRIAKGQEILHCYGPHESRMGVAERQQRLSSQYFFDCRCGA----- 597

  Fly   554 PDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGL 618
                             |..|.|..|...    ||...|       |..|..|..   .|:.|..
Mouse   598 -----------------CHAETLRAAAAP----RWEAFC-------CKTCRALMQ---GNDVLSC 631

  Fly   619 IGSSADSS-KRQALFKAFDDLDKWLVDHHSLKRI---------------MAEELVTACFYEIDGG 667
            ...|..:| .|..|.....||.:.:.....|.|.               .||..::|      ..
Mouse   632 SNESCTNSVSRDQLVSRLQDLQQQVCMAQKLLRTGKPEQAIQQLLRCREAAESFLSA------EH 690

  Fly   668 TSLDEFEYEDLARI-------------IRKQLEGIAAQCGDNSTEY------IARMTY------- 706
            |.|.|.| :.||:.             ::|.|:.:..:.|.:|.|.      :|::.:       
Mouse   691 TVLGEIE-DGLAQAHATLGNWLKSAAHVQKSLQVVETRHGPSSVEIGHELFKLAQVLFNGLAVPE 754

  Fly   707 ----LW--DIIAQKKCRTDRKELLEMK 727
                :|  :.|....|..:.:|:.|::
Mouse   755 ALSAIWKAERILLVHCGPESEEVRELR 781

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/41 (32%)
SET <447..526 CDD:214614 29/104 (28%)
Smyd4NP_001096081.1 TPR_11 68..132 CDD:290150 23/71 (32%)
TPR repeat 68..96 CDD:276809 12/35 (34%)
TPR repeat 101..136 CDD:276809 12/35 (34%)
S-adenosyl-L-methionine binding. {ECO:0000250} 112..114 1/2 (50%)
zf-MYND 296..335 CDD:280009 13/41 (32%)
SET <524..570 CDD:279228 17/46 (37%)
S-adenosyl-L-methionine binding. {ECO:0000250} 535..536 1/1 (100%)
TPR_12 658..725 CDD:290160 13/74 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56189486
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6581
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46165
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.