DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-9

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster

Alignment Length:573 Identity:110/574 (19%)
Similarity:187/574 (33%) Gaps:189/574 (33%)


  Fly   226 GRYMVAKEAISKGNVIFSERASCFVPL---------EQLLICQQCAATLMSAPIPC------PNC 275
            ||.:||..::.:|.:||.:.     ||         :.|..|..|...|......|      |.|
  Fly    34 GRGVVATRSLKRGEIIFRDS-----PLLIGLAAHEEDSLNACSVCLKMLPDTRFMCRQGCGLPVC 93

  Fly   276 HQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMW 340
            .    .|::|.:      ||.:|     |:.:..|                              
  Fly    94 S----LCAKKKQ------HKSDC-----DLFKSWG------------------------------ 113

  Fly   341 EEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELN-YHILCANLLQLYLKEHTDFYDQFHSL 404
                     |.|.:.|...:..|..|::......|:.: .:.|.|||...:..|..:....|.:.
  Fly   114 ---------PNEPDVANSVIIRLLCVARAINLSKEQRDLIYCLQANLDNNHRTEVRNAAKCFKNF 169

  Fly   405 PASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLS 469
            |.   |.:||  .::.|....|..||.  |.......:.:||         ..|.|         
  Fly   170 PT---DKKLI--EIMNRTVAVLRTNGF--DKTTDRTNDNQEF---------NYRAL--------- 209

  Fly   470 HSDPITAINLPYLSLCNHACEPSIRTKFD--GCSVVNYAAKDILEGEEIFNCYTMDYRNS----- 527
                     .|...:.||.|.|:....|:  ..:::..||.||.||.|:...||..:..:     
  Fly   210 ---------YPLFGVVNHDCIPNAYYTFEEKTNNMIVRAAVDIPEGFEVTTTYTKLFTGNIARHL 265

  Fly   528 -LKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPD-AKVQQNNLRWWL 590
             ||:::|        |.|.|::|  :||.:.........|...||....:|: ..:...|   | 
  Fly   266 FLKMKKS--------FTCKCSRC--SDPTEKGAFISGLYCRDTNCTGLVVPEITGLPHPN---W- 316

  Fly   591 RCNAEKPITCTVCHE---------LQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHH 646
                    .|.||.:         .|.||     .|.|.:..:|:..:.|.:..::.....:...
  Fly   317 --------NCLVCKQKSTHAQMMKSQDFA-----SGAINAKVNSNSLRTLVQYLNEKSDSFIPSS 368

  Fly   647 S----------LKRIM------AEELV--TACFYEIDGGTSLDEFEYED------LARIIRKQLE 687
            :          |:|:.      :|||.  |...|..|....:|:....|      |..::|::.|
  Fly   369 NYVVIDAKMSVLQRLQQGREDCSEELAHNTRLRYSRDITQLMDKLGLGDSLLRTHLEELLRREEE 433

  Fly   688 GIAAQCGDNSTEY---------IARMTYLWDIIAQKKCRTDRKELLEMKGKVD 731
            ..|.:..|.:.:.         .|....|.:::  :|.::::.|..|..|..|
  Fly   434 RRAKRLADEAEKQRKLAELQAKAAEADKLLEVL--QKEQSEQSEQAEPAGTAD 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 10/46 (22%)
SET <447..526 CDD:214614 17/81 (21%)
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 9/37 (24%)
SET <216..253 CDD:279228 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081756
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.