DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SmydA-8

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001014717.1 Gene:SmydA-8 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster

Alignment Length:488 Identity:112/489 (23%)
Similarity:160/489 (33%) Gaps:128/489 (26%)


  Fly   164 IASLEEHL----DYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGP 224
            :|:|..|:    |...: ||.:..:..|.||:|:      ||....:...|.             
  Fly    21 LAALSAHMAPCRDTTPE-QLAQLIDVHLGDLRQE------QPNWTISSSTVA------------- 65

  Fly   225 RGRYMVAKEAISKGNVIFSERASCFVPLE---QLLICQQCAATLMSAPIPCPNCHQRVVYCSRKC 286
             ||.:.|...|:.|.:||.|||....|..   ||..|..|..||......|.  |:..:.....|
  Fly    66 -GRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETLPQTGFLCR--HRCTLPVCETC 127

  Fly   287 REAHSAIHKFECAAYR----KDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLS 347
            .::..  |:.||..:|    ||:                                          
  Fly   128 SDSEE--HQAECEHFRRWQPKDV------------------------------------------ 148

  Fly   348 RKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQ 412
             ..|:.:..|..||.|..|.......::......:.||..:.|.:|.......|.:.|.:    .
  Fly   149 -DAEQEQVNPMSLRILTAVRVFHLGKEQRHLVDAMQANAERAYRREIIQAAQCFRNFPTT----D 208

  Fly   413 LIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAI 477
            .:....:.|..|.|..|........| |.|.                |.||..       |:|||
  Fly   209 RVFMDQLFRIVGVLNTNAFEAPCRSG-GHET----------------LLRGLF-------PLTAI 249

  Fly   478 NLPYLSLCNHACEPSIRTKFD-GCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYK 541
                   .||.|.|:....|: |...|..||:||.:|.||...||.....:  |.|:..||....
  Fly   250 -------MNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTYTKILWGN--LTRNIFLKMTKH 305

  Fly   542 FECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTVCHEL 606
            |.|.|.:|.....:..|||  ...|.:..||...:|   ||...|:...||     |||......
  Fly   306 FACDCVRCHDNTENGTYLS--ALFCREQGCRGLVIP---VQTRTLQPDWRC-----ITCENVFPH 360

  Fly   607 QHFAWYNEF-LGLIGSSADSSKRQALFKAFDDL 638
            ...|.|.:| |..|.:..:|...|.:....::|
  Fly   361 AKMAKYQDFALNTINNRINSCSVQDMIHFINEL 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/40 (23%)
SET <447..526 CDD:214614 23/80 (29%)
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081780
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.