| Sequence 1: | NP_610500.2 | Gene: | Smyd4-1 / 35985 | FlyBaseID: | FBgn0033427 | Length: | 751 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001100065.1 | Gene: | Smyd1 / 297333 | RGDID: | 1305105 | Length: | 490 | Species: | Rattus norvegicus | 
| Alignment Length: | 493 | Identity: | 103/493 - (20%) | 
|---|---|---|---|
| Similarity: | 162/493 - (32%) | Gaps: | 176/493 - (35%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266 
  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQ 331 
  Fly   332 EMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI-----DEELNYHILCANLLQLYL 391 
  Fly   392 KEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQP 451 
  Fly   452 ELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NY------- 505 
  Fly   506 ---------AAKDILEGEEIFNCYTMDYRNSLKL--QRSHPLKAIYKFECTCAKCTRTDPDQNYL 559 
  Fly   560 SFHRYRCEKPNCRQEFLPD-AKVQQNNLRWWLRCNAEKPI-----TCTVCHELQHFAWYNEFLGL 618 
  Fly   619 IGSSADSSKRQALFKAFDDLDKW---LVD------HHS 647 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Smyd4-1 | NP_610500.2 | zf-MYND | 258..298 | CDD:280009 | 10/39 (26%) | 
| SET | <447..526 | CDD:214614 | 18/98 (18%) | ||
| Smyd1 | NP_001100065.1 | zf-MYND | 52..90 | CDD:280009 | 14/52 (27%) | 
| SET | <194..257 | CDD:214614 | 21/110 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166342722 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG2084 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||