DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd1

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001100065.1 Gene:Smyd1 RGDID:1305105 Length:490 Species:Rattus norvegicus

Alignment Length:493 Identity:103/494 (21%)
Similarity:162/494 (33%) Gaps:176/494 (36%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            |:.|..| :||.:.|.:.....:|||:|||               :||...|:|..|.||..   
  Rat    10 EVFTSEG-KGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQERLHRCGQCKF--- 70

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQ 331
                    .|    ||.|.|::.....||.||:|    |.|...:.:..:||             
  Rat    71 --------AH----YCDRTCQKDAWLNHKNECSA----IKRYGKVPNENIRL------------- 106

  Fly   332 EMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI-----DEELNYHILCANLLQLYL 391
               :|:.||       |...|.....|  ..|..|..|...:     :|:....:.....||.:.
  Rat   107 ---AARIMW-------RVEREGTGLTE--GCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYWP 159

  Fly   392 KEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQP 451
            .:...|..|:                 |....|.:..||..     |...:|||:          
  Rat   160 PQSQQFSMQY-----------------ISHIFGVINCNGFTLSDQRGLQAVGVGI---------- 197

  Fly   452 ELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NY------- 505
                                       .|.|.|.||.|.|:       |:|:    |:       
  Rat   198 ---------------------------FPNLGLVNHDCWPN-------CTVIFNNGNHEAVKSMF 228

  Fly   506 ---------AAKDILEGEEIFNCYTMDYRNSLKL--QRSHPLKAIYKFECTCAKCTRTDPDQNYL 559
                     |...|.||||:    |:.|.:.|.|  :|...||..|.|:|:|..|.:...|..:|
  Rat   229 HTQMRIELRALGKISEGEEL----TVSYIDFLHLSEERRQQLKKQYYFDCSCEHCQKGLKDDLFL 289

  Fly   560 SFHRYRCEKPNCRQEFLPD-AKVQQNNLRWWLRCNAEKPI-----TCTVCHELQHFAWYNEFLGL 618
            :..    |.|...||.:.: .:..::.|....:..:|...     .|..|.|.|...:.:..|.:
  Rat   290 AVK----EDPKPSQEVVKEMTQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFADTNLYV 350

  Fly   619 IGSSADSSKRQALFKAFDDLDKW---LVD------HHS 647
            :...:..|:..:..:||::...:   :||      ||:
  Rat   351 LRLLSIVSEVLSYLQAFEEASHYARRMVDGYMKLYHHN 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/40 (28%)
SET <447..526 CDD:214614 18/99 (18%)
Smyd1NP_001100065.1 zf-MYND 52..90 CDD:280009 15/53 (28%)
SET <194..257 CDD:214614 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56274771
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.