DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd2

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_996733.1 Gene:Smyd2 RGDID:727785 Length:433 Species:Rattus norvegicus

Alignment Length:467 Identity:96/468 (21%)
Similarity:166/468 (35%) Gaps:154/468 (33%)


  Fly   225 RGRYMVAKEAISKGNVIFS-----------ERA----SCFVPLEQLLICQQCAATLMSAPIPCPN 274
            :||.:.|......|:::||           ||.    .||...|.|..|.:|             
  Rat    17 KGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRC------------- 68

  Fly   275 CHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGM 339
              ::..||..:|::....:||.||::                  ::.:.....|......:|:.:
  Rat    69 --KQAFYCDVECQKEDWPLHKLECSS------------------MVVFGENWNPSETVRLTARIL 113

  Fly   340 WEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHIL--CANLLQLYLKEHTDFYDQFH 402
            .::.|:..|.|.|     :.|......|.||: :|.|....|.  .|.|.|.|.| |.:|.|.  
  Rat   114 AKQKMHPERTPSE-----KLLAVREFESHLDK-LDNEKKDLIQSDIAALHQFYSK-HLEFPDH-- 169

  Fly   403 SLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHN 467
                         |:|::.|| |:..||..        :|.:|                      
  Rat   170 -------------SSLVVLFA-QVNCNGFT--------IEDEE---------------------- 190

  Fly   468 LSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCY------TMDYRN 526
            |||   :.:...|.::|.||:|.|::...:.|......|.::|..|:|:|..|      |.|   
  Rat   191 LSH---LGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTED--- 249

  Fly   527 SLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLR 591
                 |:..|:..|.|.|.|.:||..|.|:..:...  :...|       |.|:..::.:|:   
  Rat   250 -----RNDRLRDSYFFTCECRECTTKDKDKAKVEIR--KLSNP-------PQAEAIRDMVRY--- 297

  Fly   592 CNAEKPITCTVCHEL---QHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMA 653
                   ...|..|.   :|:...:|.|.:...|     ::.:...|:|.:.:::  |.:.:.|.
  Rat   298 -------ARNVIEEFRRAKHYKSPSELLEICELS-----QEKMSSVFEDSNVYML--HMMYQAMG 348

  Fly   654 EELVTACFYEID 665
                 .|.|..|
  Rat   349 -----VCLYMQD 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 8/40 (20%)
SET <447..526 CDD:214614 18/85 (21%)
Smyd2NP_996733.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:280009 12/53 (23%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
SET <204..240 CDD:279228 11/36 (31%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 1/2 (50%)
TPR_12 338..413 CDD:290160 5/26 (19%)
TPR_10 381..422 CDD:290111
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56431281
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.