DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd4

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001099280.1 Gene:Smyd4 RGDID:1307369 Length:801 Species:Rattus norvegicus

Alignment Length:871 Identity:189/872 (22%)
Similarity:314/872 (36%) Gaps:259/872 (30%)


  Fly    23 DEFETF--KSLASMPADILQIFQKLALDLLQD-------LEQPVDRKGCAERSKN---------- 68
            ||::::  :..|.:|..: |:....| :.|.|       |.||.|.....:.|.:          
  Rat     6 DEWKSYLLEKWALLPKSV-QVTISTA-ETLSDIFLHSSSLLQPEDEMFLKQLSSSCSVEKDSGAP 68

  Fly    69 --LREEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAY 131
              .|||||..|:|.       ..:.|..|||:.|..:....|::||.:|||..||...|.:....
  Rat    69 LFYREEGNKRFQEK-------EYMGAAVLYSKGVSHSRPNTEDISLCYANRSAALFHLGQHEACL 126

  Fly   132 DDCSNALECGYPERLRHKVIMRQAFCAWKLKKIASLEEHLDYLGQLQLKESFEQQL-----EDLK 191
            .|...|...||||||:.|:::|:..|   |..:..|:|....:..|:...:.:..|     :.|:
  Rat   127 KDIVRAGMHGYPERLQPKLMIRKTEC---LVNLGRLQEARQTISDLENSLTTKPTLMPSSHQILQ 188

  Fly   192 QKLELLKNQPREQETQGK---------VVDKSLGE-------------ILTDPGPRGRYMVAKEA 234
            :.::.||.:.:|:||..:         :.|.:|||             :.||| .:||::||.:.
  Rat   189 RNVQQLKMKIQEKETLPESFPAALTKALEDMALGEENKQISGASLSVSLCTDP-LKGRHLVATKD 252

  Fly   235 ISKGNVIFSERASCFV-------PLEQL-------------LICQQCAATLMSAPIPCPNCHQRV 279
            |..|.::..|.|...|       ||...             |.|.:|....: |.:||..| ...
  Rat   253 ILPGELLVKEDAFVSVLNPGEMPPLRHCLENKWDTRVTSADLYCHRCLRHTL-ATVPCGGC-SYA 315

  Fly   280 VYCSRKC-REAHSAIHKFECAAYRKDILRLLGI-SHLALRLLL--------TYIPYI-------- 326
            .|||::| ::|....|..||:.  ..:|..||: .|:|||:.|        ..|..|        
  Rat   316 KYCSQECVQQAWDHYHSTECSL--GGLLLTLGVFCHVALRMTLLARFEDVDRVIRMICDKTGRKD 378

  Fly   327 --RPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQL 389
              .|..:::....|    ..|.....|.||.....:....:..:.:...|..|:           
  Rat   379 TCLPESKDLVKTFG----YTNQGESEENSETCEPSIPGCNVNGKYENNYDAVLS----------- 428

  Fly   390 YLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPEL- 453
             |..||:.:...|....::.     :|||    ..||.|.......   .|::......:.|.| 
  Rat   429 -LLPHTEKHSPEHKFICAVS-----VSAL----CRQLKATSLQAQT---TGLKSPRLKAVTPGLC 480

  Fly   454 -----W--QKPRHLKRGQLHNLSHSDPITAI---------------------NLPYLSLCNHACE 490
                 |  ...:|:.:.|    .::..||:|                     ..|.:||.||:|.
  Rat   481 TDLTVWGVAMLQHMLQLQ----CNAQAITSICYAGSKESIITNSRQVRLATGVFPVVSLLNHSCS 541

  Fly   491 PSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPD 555
            |:....|........||:.|.:|:||.:||..........:|...|.:.|.|:|:|         
  Rat   542 PNTSVSFTSTVATIRAAQQIAKGQEILHCYGPHESRMGVAERQQRLSSQYFFDCSC--------- 597

  Fly   556 QNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTVCH-ELQHFAWYNEFLGLI 619
                         |.|..|.|..|...    ||...|       |..|. .:|.    |:.|...
  Rat   598 -------------PACHAETLRAAVAP----RWEAFC-------CNTCRVPMQG----NDVLSCS 634

  Fly   620 GSSADSS-KRQALFKAFDDLDKWLVDHHSLKRIM------------------AEELVTA---CFY 662
            ..|..:| .|..|.....||.:.:   |:.::::                  ||..::|   ...
  Rat   635 NESCTNSVSRDRLVSRLQDLQQQV---HTAQKLLRSDRPEQAIQQLLECQRAAENFLSAEHTVLG 696

  Fly   663 EIDGG-----TSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEY------IARMTY---------- 706
            ||:.|     .:|.  ::...|..::|.|:.:.|:.|.:|.|.      :|::.:          
  Rat   697 EIEDGLAQAYATLG--DWRQSAAHVQKSLQVVEARHGPSSVEIGHELFKLAQVLFNGLAVPEALD 759

  Fly   707 -LWDIIAQK----KCRTDRKELLEMK 727
             :|.  |:|    .|..:..|:.|::
  Rat   760 AIWK--AEKILLVHCGPESDEVQELR 783

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/41 (32%)
SET <447..526 CDD:214614 24/108 (22%)
Smyd4NP_001099280.1 TPR_11 68..132 CDD:290150 22/71 (31%)
TPR repeat 68..96 CDD:276809 12/35 (34%)
TPR repeat 101..136 CDD:276809 11/35 (31%)
zf-MYND 296..335 CDD:280009 13/41 (32%)
SET <526..572 CDD:279228 16/46 (35%)
TPR_12 692..>748 CDD:290160 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56191281
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1278034at2759
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46165
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.