DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd5

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 MGIID:108048 Length:416 Species:Mus musculus

Alignment Length:445 Identity:109/446 (24%)
Similarity:155/446 (35%) Gaps:162/446 (36%)


  Fly   210 VVDKSLG--EILTDPGPRGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMS 267
            |.|::.|  |:......:|:.:.|.:.|.||..||.||   |:.|:  .|.|...|..|...|..
Mouse    15 VADRARGSVEVRYVDSIKGKGLFATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEK 79

  Fly   268 A---------------PIP------------CPNCHQRVVYCSRKCR-EAHSAIHKFECAAYRKD 304
            |               |.|            ||:|  :|:|||.:|| .|....|:..|.     
Mouse    80 AEENAQRLTGKPSQILPHPELCSVRKDLHQNCPHC--QVMYCSAECRLAAAEQYHQILCP----- 137

  Fly   305 ILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQL 369
                 |.||..           |..|.::..|   |..:    ..|.|:.:   .:...|||:.:
Mouse   138 -----GPSHDP-----------RHPLNKLQEA---WRSV----HYPPETAS---IMLMARMVATV 176

  Fly   370 DQAIDEELNYHILCANLLQLYLKEH-TDFYDQFHSLPASIEDWQLIISALIL-RFAGQLLANGHV 432
            .||.|                 |:| ...::.|.|..|:.|  |.|:..|:. :|..||      
Mouse   177 KQAKD-----------------KDHWVRLFNHFCSRTANQE--QAIVHKLLKGKFKDQL------ 216

  Fly   433 GDALLGVGMEPKEFVMLQPE---LWQKPRHLK--------RGQ----------LH-----NLSHS 471
             :.|||:..|     .|..|   ||..|...:        .||          :|     .|:..
Mouse   217 -ELLLGLFKE-----ALYEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQ 275

  Fly   472 D-------------PITAINLPYL-----------SLCNHACEPSIRTKFDGCSVVNY--AAKDI 510
            |             .|.|....:|           |.|||:|.|:..|.|...:.|.:  |.:||
Mouse   276 DREQLDTFIDQLYKDIEAATGEFLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDI 340

  Fly   511 LEGEEIFNCYTMDYRNSLKLQRSHP-----LKAIYKFECTCAKCTRTDPDQNYLS 560
            ..||||  |  :.|.:..:.:||..     |:..|.|.|:|.||.....|.|..|
Mouse   341 KPGEEI--C--ISYLDCCQRERSRHSRHKILRENYLFNCSCPKCLAEADDPNVTS 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 17/68 (25%)
SET <447..526 CDD:214614 31/131 (24%)
Smyd5NP_659167.2 SET <297..350 CDD:214614 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.