DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd2

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_081072.1 Gene:Smyd2 MGIID:1915889 Length:433 Species:Mus musculus

Alignment Length:465 Identity:92/466 (20%)
Similarity:168/466 (36%) Gaps:150/466 (32%)


  Fly   225 RGRYMVAKEAISKGNVIFS-----------ERA----SCFVPLEQLLICQQCAATLMSAPIPCPN 274
            :||.:.|......|:::||           ||.    .||...|.|..|.:|             
Mouse    17 KGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRC------------- 68

  Fly   275 CHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGM 339
              ::..||..:|::....:||.||::     :.:||.:.             .|......:|:.:
Mouse    69 --KQAFYCDVECQKEDWPLHKLECSS-----MVVLGENW-------------NPSETVRLTARIL 113

  Fly   340 WEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSL 404
            .::.::..|.|.|     :.|......|.||:..:|:       .:|:|..:.....||.::...
Mouse   114 AKQKIHPERTPSE-----KLLAVREFESHLDKLDNEK-------KDLIQSDIAALHQFYSKYLEF 166

  Fly   405 PASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLS 469
            |..        |:|::.|| |:..||..        :|.:|                      ||
Mouse   167 PDH--------SSLVVLFA-QVNCNGFT--------IEDEE----------------------LS 192

  Fly   470 HSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCY------TMDYRNSL 528
            |   :.:...|.::|.||:|.|::...:.|......|.::|..|:|:|..|      |.|     
Mouse   193 H---LGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTED----- 249

  Fly   529 KLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCN 593
               |:..|:..|.|.|.|.:||..|.|:..:...  :...|       |.|:..::.:|:     
Mouse   250 ---RNDRLRDSYFFTCECRECTTKDKDKAKVEVR--KLSSP-------PQAEAIRDMVRY----- 297

  Fly   594 AEKPITCTVCHEL---QHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEE 655
                 ...|..|.   :|:...:|.|.:...|     ::.:...|:|.:.:::  |.:.:.|.  
Mouse   298 -----ARNVIEEFRRAKHYKSPSELLEICELS-----QEKMSSVFEDSNVYML--HMMYQAMG-- 348

  Fly   656 LVTACFYEID 665
               .|.|..|
Mouse   349 ---VCLYMQD 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 8/40 (20%)
SET <447..526 CDD:214614 18/85 (21%)
Smyd2NP_081072.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:307734 12/53 (23%)
SET <157..240 CDD:307139 27/125 (22%)
Peptide substrate binding. {ECO:0000250} 183..185 1/2 (50%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56428784
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.