DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and set-10

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_493620.2 Gene:set-10 WormBaseID:WBGene00009370 Length:430 Species:Caenorhabditis elegans

Alignment Length:543 Identity:96/544 (18%)
Similarity:174/544 (32%) Gaps:203/544 (37%)


  Fly   228 YMVAKE----AISKGNVIFSER--ASCFVPLE-----QLLICQQCAATLMSAPIPCPNCHQRVVY 281
            |.||:|    |:....  |||.  |:||:.::     ::|.|..|.|               |.|
 Worm     2 YTVAREQPLAAVLSPQ--FSELYCATCFLEIDSSQETEILTCDDCLA---------------VSY 49

  Fly   282 CSRKC-REAHSAIHKFECAAYRKDILRLLGIS-------HLALRLLL----TYIPYIRPHLQEMT 334
            |:.|| |:...:.|:|||     :|||..|.|       .|.:|:||    |..|.....:.|  
 Worm    50 CTLKCQRKDWKSCHQFEC-----EILRCQGSSTPMTLTMKLCIRVLLASRSTQTPSFNGAVLE-- 107

  Fly   335 SAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYD 399
                      :|....:|..::||:.:.|..|..:..:..:.:                      
 Worm   108 ----------DLETNYKEFRSSPEHNQFLSDVLTIISSSGQNI---------------------- 140

  Fly   400 QFHSLPASIEDWQ---LIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLK 461
                .|.|:|..:   :|.|.|...|:                                      
 Worm   141 ----FPTSLETNKTIGIICSVLCNSFS-------------------------------------- 163

  Fly   462 RGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRN 526
               :.|....:||.:.....::..||:|..:....|:|..|.....:     ||.....|:.|.:
 Worm   164 ---IINEKRVEPIGSGLYVGVAKHNHSCASTSHVVFEGNQVFLRTNQ-----EEYSKELTISYVS 220

  Fly   527 SL--KLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWW 589
            .:  ..:|...::.::...|.|..|...:.|...||   .:|...|| ..|:..:.         
 Worm   221 RMLPTSERRKTIRGVHFLTCQCEMCKNEELDLIGLS---SKCRTKNC-TGFVKGSG--------- 272

  Fly   590 LRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAE 654
                     .|:||.:|....:                .|::....:.||            :.|
 Worm   273 ---------NCSVCEKLAFLPF----------------EQSIHSTLNLLD------------IIE 300

  Fly   655 ELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQKKCRTD 719
            .|     ::.:..|::.|..|   .:.:|...:.|.|:|.....:...::.|         |.:.
 Worm   301 NL-----HKTNQFTTVQELAY---LQKLRADYQDILAECNVAILQLDEQIAY---------CSSS 348

  Fly   720 RKELLEMKGKVDYLASEHREVFL 742
            .:.:.::  .:|.:|....|.|:
 Worm   349 LENVNDL--DLDLIAGRGSEHFI 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/41 (29%)
SET <447..526 CDD:214614 13/79 (16%)
set-10NP_493620.2 zf-MYND 23..67 CDD:280009 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.