DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and set-3

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_499143.1 Gene:set-3 WormBaseID:WBGene00007403 Length:465 Species:Caenorhabditis elegans

Alignment Length:342 Identity:76/343 (22%)
Similarity:121/343 (35%) Gaps:93/343 (27%)


  Fly   225 RGRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNC-----HQRVVYCSR 284
            |||::.|.|.|..|.|                :|.:...|:...|..|..|     :....|| :
 Worm    28 RGRFVEAIEDIPIGTV----------------VCVETGITVNVDPQNCYRCLKITENASFAYC-K 75

  Fly   285 KCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNL--S 347
            .|.|.:.. .:..|..:.:     |||..||..|:.:| |:               .:|.:|  |
 Worm    76 NCEEFYEP-DEIACGEFDE-----LGIFKLAAHLVFSY-PF---------------ADIASLVQS 118

  Fly   348 RKPEESENAPEYL--RSLRMVSQLD--QAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASI 408
            ..||....||:.|  :.:..:.||.  ..|.|...     |..:|..:|...:      ||... 
 Worm   119 SDPEPPSCAPKALSTQDIEAIFQLTPFPEIGEAFK-----APAIQNAIKRIVE------SLETD- 171

  Fly   409 EDW---QLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSH 470
            |:|   ..|...:....|.:::|.....:|.....:|..|                 .|..||  
 Worm   172 ENWGRLDQISRTMTFTKALRIMAERSAKNAHTIYSIEQIE-----------------SQEDNL-- 217

  Fly   471 SDPITAINLPYLSLCNHACEPSIRTKFDGCSVVN---YAAKDILEGEEIFNCYTMDYRNSLKLQR 532
              |:.....|..|:.||:|.|:|    .|..|.|   :.::.:...||:.:.|.:.|......||
 Worm   218 --PMATGLFPISSIFNHSCTPNI----SGFFVRNTFIFVSQGVRAREELLDSYGVTYHQHTFEQR 276

  Fly   533 SHPLKAIYKFECTCAKC 549
            ::.|.::..|.|.|..|
 Worm   277 TNFLASVSGFICHCESC 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/45 (20%)
SET <447..526 CDD:214614 18/82 (22%)
set-3NP_499143.1 SET <220..271 CDD:214614 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6581
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463653at33208
OrthoFinder 1 1.000 FOG0002920
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5130
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.