DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and set-30

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_508850.2 Gene:set-30 WormBaseID:WBGene00022499 Length:560 Species:Caenorhabditis elegans

Alignment Length:346 Identity:68/347 (20%)
Similarity:118/347 (34%) Gaps:121/347 (35%)


  Fly   245 RASCFVPLEQLLI-------CQQCAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYR 302
            |:..|.|....|:       |..|...  :..:.|..| :...:||::|..:.:..||:||...:
 Worm    21 RSKEFYPFAYSLLDCTKDDYCWTCLGE--NVELTCEQC-KVAKFCSKQCETSGAIDHKYECGPLK 82

  Fly   303 K--DI---LRLLGISHLALRLLLTY----------IPYIRPHLQEMTSAKGMWEEIMNLSRKPEE 352
            |  |:   .|:|      :|::..|          |.....:.:...|...:||...::    ::
 Worm    83 KCPDLNTDERML------IRIVGRYKDIHSGKDKSIDGFYNNRESKRSVMEIWEHCADM----KK 137

  Fly   353 SENAPEYLRS----LRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQL 413
            .|||.:..:.    ::.....:..:|||:.:                    |.||          
 Worm   138 DENAMKSFKKTYDRVKQFGDTNHLMDEEVTF--------------------QLHS---------- 172

  Fly   414 IISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAIN 478
                                          :.|:                ..|::|:.|.:..|.
 Worm   173 ------------------------------RNFI----------------NRHSISNVDYLREIG 191

  Fly   479 LP-YLSLC--NHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNC-YTMDYRNSLKLQRSHPLKAI 539
            .. ||.||  :|:|.|:.....:|......|..|.::.|.:... ||.......|:||.|.||..
 Worm   192 KGLYLDLCKYDHSCRPNAIYSCNGIVAKLRALHDNVDLENVETTHYTYIELPPCKIQRRHMLKET 256

  Fly   540 YKFECTCAKCTRTDPDQNYLS 560
            :.|||.|.:|  .|||.|:|:
 Worm   257 WYFECHCERC--DDPDDNWLT 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 10/40 (25%)
SET <447..526 CDD:214614 17/83 (20%)
set-30NP_508850.2 zf-MYND 41..78 CDD:280009 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.