DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and set-14

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_496323.1 Gene:set-14 WormBaseID:WBGene00011068 Length:429 Species:Caenorhabditis elegans

Alignment Length:455 Identity:103/456 (23%)
Similarity:148/456 (32%) Gaps:163/456 (36%)


  Fly   258 CQQCAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYR------KDILRLLGISHLAL 316
            |.|| .|.|:....|..| :|:.|||::|:.|...:||.||.|.:      .|.:||  :..:|.
 Worm    26 CNQC-LTSMAELKKCSAC-RRLAYCSQECQRADWKLHKVECKAIKTHNEVANDSIRL--VMRIAG 86

  Fly   317 RLLLT--------YIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI 373
            :|...        |||             |:.....||...|...:                  .
 Worm    87 KLSRNEDGEIEAYYIP-------------GVARNFQNLEHHPSSYD------------------A 120

  Fly   374 DEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLG 438
            |||            .::||    |.||...|....|   :|..:..:.:......|:.....:|
 Worm   121 DEE------------SFVKE----YFQFAIAPHPDRD---LIKLIFQKVSINSFVVGNSTGNPIG 166

  Fly   439 VGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSV- 502
            ||:..|                                     ||..||:|:|..|..:...:. 
 Worm   167 VGLCIK-------------------------------------LSAANHSCKPLTRVCYRNRTAM 194

  Fly   503 ---VNYAAKDILEGEEIFNCYTMDYRNSL--KLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFH 562
               |:......|||.    |::  |.:.|  :..|...||..|||.|.|..|  .|.|:|     
 Worm   195 LVPVSSELPSTLEGA----CHS--YIDELMPRDMRRDTLKKKYKFLCQCDGC--LDEDRN----- 246

  Fly   563 RYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKPITCTVC---HELQHFAWYN--EFLGLIGSS 622
             .|.|...|           ...::.|:| |.|.. .|.:|   ....||....  |..|:...|
 Worm   247 -ARMEAWTC-----------GICVKGWMR-NKENG-QCELCGWTMSKDHFELCRTAEEAGIAARS 297

  Fly   623 A---DS----SKRQALFKAFDDLDKWLVDHHSLKRI----------MAEELVTACFYEIDGGTSL 670
            .   |:    :||....|..|.....|.| |::.||          :|.:.:||.  ...|||.|
 Worm   298 RLANDAIPLETKRNLCEKLLDLFQDTLHD-HNVHRIPVLRCLYICSLAAQNITAA--AKTGGTLL 359

  Fly   671  670
             Worm   360  359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 16/40 (40%)
SET <447..526 CDD:214614 13/83 (16%)
set-14NP_496323.1 zf-MYND 26..64 CDD:280009 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.