DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and set-18

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_871849.1 Gene:set-18 WormBaseID:WBGene00044070 Length:507 Species:Caenorhabditis elegans

Alignment Length:593 Identity:117/594 (20%)
Similarity:181/594 (30%) Gaps:249/594 (42%)


  Fly   198 KNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISK------------GNVIFSERASCFV 250
            ||.|:::                ||      :|.|:.||.            ...:.:.:.|.| 
 Worm     7 KNVPKQE----------------DP------LVQKDEISSIHARIKIFETPFATQVLNPKVSEF- 48

  Fly   251 PLEQLLICQQCAATLMSAPIP------CPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLL 309
                   |..|    :..|.|      |..|:.. :|||::|:.....:||.||.          
 Worm    49 -------CANC----LRGPAPGEKLLRCGGCNFS-MYCSKECQATAWLVHKPECK---------- 91

  Fly   310 GISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAID 374
                 .|:.....:|     |.|:.....:.:.|..|.:..::.....|...|..:..::|...|
 Worm    92 -----RLKASFPNLP-----LTEVLFLSKVIDRIQFLEKNGDKLGIEAERKFSSLVDHKVDIRDD 146

  Fly   375 EELNYHILCANLLQLYLK----------EHTDFYDQF-------HSLPASIEDWQLIISALILRF 422
            ||     ..|:..:::.|          |..:|:|.|       ||:..:               
 Worm   147 EE-----KMAHFEKIFEKMGAFRGEEMIEKGEFFDVFCKATINSHSIHTN--------------- 191

  Fly   423 AGQLLANGHVGDAL-LGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCN 486
                 |...||.|| |||                                           |..|
 Worm   192 -----AGNEVGMALDLGV-------------------------------------------SKYN 208

  Fly   487 HACEPSIRTKFDGCSVVNYAAKDILEG------EEIFNCYTMDYRNSLKLQRSHPLKAIYKFECT 545
            |:|.|:....|||..|   ..:.::.|      ||.|..| :|...| |..|...|.:.:.|.|.
 Worm   209 HSCRPTCSMVFDGYRV---CLRPLVPGVDAENTEEAFISY-IDVGRS-KYIRRRDLNSRWYFNCE 268

  Fly   546 CAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQNNLRWWLRCNAEKP--ITCTVCHELQH 608
            |.:|  .||:.:.|:  ..||..|.|      ||.:        |....|:|  |.|..|     
 Worm   269 CTRC--MDPEDDALT--AIRCANPAC------DAPI--------LTSETEEPMNIACEKC----- 310

  Fly   609 FAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYEIDGGTSLDEF 673
                                           |.:|:..::|  .|:|.:.......|.....   
 Worm   311 -------------------------------KTIVEEDTVK--AAQEYMKTLPASFDPKCPA--- 339

  Fly   674 EYEDLARIIRKQLEGIAAQCGDNSTEYIARMTYLWDIIAQKKCRTDRKELLEMKG--KVDYLASE 736
            |.|.|...: |:|...|.|....|..|:||:               |..|..:.|  .:|.|:|.
 Worm   340 EIEALPGKL-KELLAKAEQILHPSNVYVARL---------------RTALFHVTGTLTMDNLSSM 388

  Fly   737 HREVFLNY 744
            |.:::.||
 Worm   389 HTQIYNNY 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/46 (28%)
SET <447..526 CDD:214614 15/85 (18%)
set-18NP_871849.1 zf-MYND 49..90 CDD:280009 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.