DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SMYD1

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_938015.1 Gene:SMYD1 HGNCID:20986 Length:490 Species:Homo sapiens

Alignment Length:407 Identity:87/408 (21%)
Similarity:130/408 (32%) Gaps:157/408 (38%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            |:.|..| :||.:.|.:.....::||:|||               :||...|:|..|.||..   
Human    10 EVFTAEG-KGRGLKATKEFWAADIIFAERAYSAVVFDSLVNFVCHTCFKRQEKLHRCGQCKF--- 70

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQ 331
                    .|    ||.|.|::.....||.||:|    |.|...:.:..:||             
Human    71 --------AH----YCDRTCQKDAWLNHKNECSA----IKRYGKVPNENIRL------------- 106

  Fly   332 EMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI-----DEELNYHILCANLLQLYL 391
               :|:.||       |...|.....|  ..|..|..|...:     :|:.:..:.....||.:.
Human   107 ---AARIMW-------RVEREGTGLTE--GCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQYWP 159

  Fly   392 KEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQP 451
            .:...|..|:                 |....|.:..||..     |...:|||:          
Human   160 PQSQQFSMQY-----------------ISHIFGVINCNGFTLSDQRGLQAVGVGI---------- 197

  Fly   452 ELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NY------- 505
                                       .|.|.|.||.|.|:       |:|:    |:       
Human   198 ---------------------------FPNLGLVNHDCWPN-------CTVIFNNGNHEAVKSMF 228

  Fly   506 ---------AAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSF 561
                     |...|.||||:...| :|:.| :..:|...||..|.|:|||..|.:...|..:|..
Human   229 HTQMRIELRALGKISEGEELTVSY-IDFLN-VSEERKRQLKKQYYFDCTCEHCQKKLKDDLFLGV 291

  Fly   562 HRYRCEKPNCRQEFLPD 578
            .    :.|...||.:.:
Human   292 K----DNPKPSQEVVKE 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/40 (28%)
SET <447..526 CDD:214614 18/99 (18%)
SMYD1NP_938015.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/2 (50%)
zf-MYND 52..90 CDD:307734 15/53 (28%)
SET <194..257 CDD:214614 21/108 (19%)
S-adenosyl-L-methionine binding. {ECO:0000250} 205..206 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 270..272 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56273105
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.