DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and Smyd1

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001153599.1 Gene:Smyd1 MGIID:104790 Length:490 Species:Mus musculus

Alignment Length:500 Identity:103/500 (21%)
Similarity:159/500 (32%) Gaps:190/500 (38%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            |:.|..| :||.:.|.:.....:|||:|||               :||...|:|..|.||..   
Mouse    10 EVFTSEG-KGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQEKLHRCGQCKF--- 70

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIR-PHL 330
                    .|    ||.|.|::.....||.||||.:|                     |.: |:.
Mouse    71 --------AH----YCDRTCQKDAWLNHKNECAAIKK---------------------YGKVPNE 102

  Fly   331 QEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI-----DEELNYHILCANLLQLY 390
            ....:|:.||       |...|.....|  ..|..|..|...:     :|:....:.....||.:
Mouse   103 NIRLAARIMW-------RVEREGTGLTE--GCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYW 158

  Fly   391 LKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQ 450
            ..:...|..|:                 |....|.:..||..     |...:|||:         
Mouse   159 PPQSQQFSMQY-----------------ISHIFGVINCNGFTLSDQRGLQAVGVGI--------- 197

  Fly   451 PELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NY------ 505
                                        .|.|.|.||.|.|:       |:|:    |:      
Mouse   198 ----------------------------FPNLGLVNHDCWPN-------CTVIFNNGNHEAVKSM 227

  Fly   506 ----------AAKDILEGEEIFNCYTMDYRNSLKL--QRSHPLKAIYKFECTCAKCTRTDPDQNY 558
                      |...|.||||:    |:.|.:.|.|  :|...||..|.|:|:|..|.:...|..:
Mouse   228 FHTQMRIELRALGKISEGEEL----TVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLF 288

  Fly   559 LSFHRYRCEKPNCRQEFLPDA------------KVQQNNLRWWLRCNAEKPITCTVCHELQHFAW 611
            |:..    |.|...||.:.:.            |.:...|      ..|....|..|.|.|...:
Mouse   289 LAAK----EDPKPSQEVVKEMIQFSKDTLEKIDKARSEGL------YHEVVKLCRECLEKQEPVF 343

  Fly   612 YNEFLGLIGSSADSSKRQALFKAFDDLDKW---LVD------HHS 647
            .:..|.::...:.:|:..:..:|:::...:   :||      ||:
Mouse   344 ADTNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHN 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/40 (28%)
SET <447..526 CDD:214614 18/99 (18%)
Smyd1NP_001153599.1 S-adenosyl-L-methionine binding 17..19 1/2 (50%)
zf-MYND 52..90 CDD:280009 15/53 (28%)
SET <194..257 CDD:214614 22/111 (20%)
S-adenosyl-L-methionine binding 205..206 1/1 (100%)
S-adenosyl-L-methionine binding. {ECO:0000250} 270..272 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56269844
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.