DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and Smyd1

DIOPT Version :8

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001153599.1 Gene:Smyd1 / 12180 MGIID:104790 Length:490 Species:Mus musculus

Alignment Length:500 Identity:103/500 - (20%)
Similarity:159/500 - (31%) Gaps:190/500 - (38%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            |:.|..| :||.:.|.:.....:|||:|||               :||...|:|..|.||..   
Mouse    10 EVFTSEG-KGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQEKLHRCGQCKF--- 70

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIR-PHL 330
                    .|    ||.|.|::.....||.||||.:|                     |.: |:.
Mouse    71 --------AH----YCDRTCQKDAWLNHKNECAAIKK---------------------YGKVPNE 102

  Fly   331 QEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAI-----DEELNYHILCANLLQLY 390
            ....:|:.||       |...|.....|  ..|..|..|...:     :|:....:.....||.:
Mouse   103 NIRLAARIMW-------RVEREGTGLTE--GCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLQYW 158

  Fly   391 LKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQ 450
            ..:...|..|:                 |....|.:..||..     |...:|||:         
Mouse   159 PPQSQQFSMQY-----------------ISHIFGVINCNGFTLSDQRGLQAVGVGI--------- 197

  Fly   451 PELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NY------ 505
                                        .|.|.|.||.|.|:       |:|:    |:      
Mouse   198 ----------------------------FPNLGLVNHDCWPN-------CTVIFNNGNHEAVKSM 227

  Fly   506 ----------AAKDILEGEEIFNCYTMDYRNSLKL--QRSHPLKAIYKFECTCAKCTRTDPDQNY 558
                      |...|.||||:    |:.|.:.|.|  :|...||..|.|:|:|..|.:...|..:
Mouse   228 FHTQMRIELRALGKISEGEEL----TVSYIDFLHLSEERRRQLKKQYYFDCSCEHCQKGLKDDLF 288

  Fly   559 LSFHRYRCEKPNCRQEFLPDA------------KVQQNNLRWWLRCNAEKPITCTVCHELQHFAW 611
            |:..    |.|...||.:.:.            |.:...|      ..|....|..|.|.|...:
Mouse   289 LAAK----EDPKPSQEVVKEMIQFSKDTLEKIDKARSEGL------YHEVVKLCRECLEKQEPVF 343

  Fly   612 YNEFLGLIGSSADSSKRQALFKAFDDLDKW---LVD------HHS 647
            .:..|.::...:.:|:..:..:|:::...:   :||      ||:
Mouse   344 ADTNLYVLRLLSIASEVLSYLQAYEEASHYARRMVDGYMKLYHHN 388

Known Domains:


Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 10/39 (26%)
SET <447..526 CDD:214614 18/98 (18%)
Smyd1NP_001153599.1 S-adenosyl-L-methionine binding 17..19 0/1 (0%)
zf-MYND 52..90 CDD:280009 14/52 (27%)
SET <194..257 CDD:214614 21/110 (19%)