DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and SMYD5

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_006053.2 Gene:SMYD5 HGNCID:16258 Length:418 Species:Homo sapiens

Alignment Length:408 Identity:98/409 (24%)
Similarity:148/409 (36%) Gaps:119/409 (29%)


  Fly   225 RGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMSA---------------P 269
            :|:.:.|.:.|.||..||.||   |:.|:  .|.:...|..|...|..|               |
Human    32 KGKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLP 96

  Fly   270 IP------------CPNCHQRVVYCSRKCR-EAHSAIHKFEC-AAYRKDILRLLGISHLALRLLL 320
            .|            ||:|  :|:|||.:|| .|....|:..| ...:.|.|..|.....|.|.: 
Human    97 HPELCTVRKDLHQNCPHC--QVMYCSAECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEAWRSI- 158

  Fly   321 TYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQL--DQAIDEELNYHILC 383
                    |....|::      ||.::|.....:.|.:..|.:|:.||.  ..|.:||...|.|.
Human   159 --------HYPPETAS------IMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLL 209

  Fly   384 AN-------LLQ------LYLKEHTDFY--DQFHSL------------PASIEDWQLIISALILR 421
            .:       ||:      ||.:..:.::  |.|.||            .:|:..|.         
Human   210 GDKFKGQLELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWV--------- 265

  Fly   422 FAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQ--KPRHLKRGQLHNLSHSDPITAINLPYLSL 484
                     |..|.|   .::|::...|...:.|  |......|:..|...|....     ..|.
Human   266 ---------HACDTL---ELKPQDREQLDAFIDQLYKDIEAATGEFLNCEGSGLFV-----LQSC 313

  Fly   485 CNHACEPSIRTKFDGCSVVNY--AAKDILEGEEIFNCYTMDYRNSLKLQRSHP-----LKAIYKF 542
            |||:|.|:..|.|...:.:.:  |.:||..||||  |  :.|.:..:.:||..     |:..|.|
Human   314 CNHSCVPNAETSFPENNFLLHVTALEDIKPGEEI--C--ISYLDCCQRERSRHSRHKILRENYLF 374

  Fly   543 ECTCAKCTRTDPDQNYLS 560
            .|:|.||.....:.|..|
Human   375 VCSCPKCLAEADEPNVTS 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 17/68 (25%)
SET <447..526 CDD:214614 23/83 (28%)
SMYD5NP_006053.2 SET <298..351 CDD:214614 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.