DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd4-1 and smyd1

Sequence 1:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_012811600.1 Gene:smyd1 XenbaseID:XB-GENE-978314 Length:491 Species:Xenopus tropicalis

Alignment Length:514 Identity:107/515 (21%)
Similarity:171/515 (33%) Gaps:220/515 (43%)


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            ||....| :||.:.|......|::||:|.|               |||...|:||.|.||..   
 Frog     5 EIFESEG-KGRGLRAIRESWAGDIIFAEPAYSAVVFDNLSHSVCHSCFKRQEKLLRCGQCKF--- 65

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRK------DILRLLGISHLALRLLLTYIPY 325
                    .|    ||.|.|::...|.||.||.|.:|      :.:||                 
 Frog    66 --------AH----YCDRTCQKESWANHKNECVAIKKAGKAPNENIRL----------------- 101

  Fly   326 IRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLY 390
                     :|:.:|       |...|.....|..    :||     ||:               
 Frog   102 ---------AARILW-------RIEREGSGLTEGC----LVS-----IDD--------------- 126

  Fly   391 LKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEP-KEFVMLQPELW 454
            |:.|.|.:|                                  :|..|:.||. ::|:    |.|
 Frog   127 LQNHIDKFD----------------------------------EAEKGLLMEDVQKFL----EYW 153

  Fly   455 QKPRHLKRGQLHNLSHSDPITAIN-----------------LPYLSLCNHACEPSIRTKFDGCSV 502
              |...::..:..:||...:.:.|                 .|.|.|.||.|.|:       |:|
 Frog   154 --PSQSQQFGMQYISHIFSVISCNGFTLSDQRGLQAVGVGIFPNLCLANHDCWPN-------CTV 209

  Fly   503 V----NY----------------AAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCA 547
            :    |:                |...|.:|||:...| :|:.| |...|...||..|.|:|||.
 Frog   210 IFNNGNHEAVRSMFHTQMRIELRALGKINKGEELTVSY-VDFLN-LTEDRKAQLKKQYYFDCTCE 272

  Fly   548 KCTRTDPD------------------QNYLSFHRYRCEK-PNCRQEFLPD--AKVQQNNLRWWLR 591
            .||:...|                  :..:.:.:...|| ...|.|.|.:  .|:.::.|:    
 Frog   273 HCTKKTKDALLLAVKDGEDKPEERVVKEVIQYSKDTMEKIEKARSEGLYNDVVKLCRDCLK---- 333

  Fly   592 CNAEKPITC-TVCHELQHFAWYNE---FLGLIGSSADSSKRQALFKAFDDLDKWLVDHH 646
              .::||.. |..:.|:..:.|:|   :|.:...:|:::|:.        :|.:|..:|
 Frog   334 --RQEPIFADTNIYMLRILSIYSEVLSYLQMFDDAAENAKKM--------VDGYLKIYH 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/40 (30%)
SET <447..526 CDD:214614 23/116 (20%)
smyd1XP_012811600.1 zf-MYND 47..85 CDD:280009 18/53 (34%)
SET <189..252 CDD:214614 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56268048
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.