DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or94a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:421 Identity:90/421 - (21%)
Similarity:149/421 - (35%) Gaps:112/421 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLSRNYPLAKHLFFVTRYSFGLLGLRFGKEQSWLHLLWL-VFNFVNLAHCCQAEFVFGWSHLRTS 68
            |:.|||....||    ..:|..:|           |:|| .|...||....|.            
  Fly    39 FVKRNYRFLLHL----PITFTFIG-----------LMWLEAFISSNLEQAGQV------------ 76

  Fly    69 PVDAMDAFCPLACSFTTL---FKLGWMWWRRQEVADLMDRIR----LLIGEQEKREDSRRKVAQR 126
                      |..|.|.:   .|:..:|..|.|...||..::    ..:..||:.:..||:....
  Fly    77 ----------LYMSITEMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEEVDFWRREQRFF 131

  Fly   127 SYYLMVTRCGMLVFTLGSI---TTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPV 188
            .::..:    .::.:||.:   .||...|.. :|:      .|.:.:||...    ..|..||..
  Fly   132 KWFFYI----YILISLGVVYSGCTGVLFLEG-YEL------PFAYYVPFEWQ----NERRYWFAY 181

  Fly   189 FY----LYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESK---- 245
            .|    :..|....:|:    .|.|.:|.|.:.:.:.|..||              |||:|    
  Fly   182 GYDMAGMTLTCISNITL----DTLGCYFLFHISLLYRLLGLR--------------LRETKNMKN 228

  Fly   246 --ICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNI------ 302
              |..|:|..|...|..|..:......|::.......:.::|:|.        :|||.:      
  Fly   229 DTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIIC--------FSGYRLQHVGIR 285

  Fly   303 ------IRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQ 361
                  |..:.:...:...|:|.||.|.|::..:..|....|.:.|.......|:.:...:...:
  Fly   286 DNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLK 350

  Fly   362 RPITVRV-PFFAPSLPVFTSVIKFTGSIVAL 391
            :|:|:|. .|||..||:|...|....|.:||
  Fly   351 KPVTIRAGNFFAVGLPIFVKTINNAYSFLAL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 72/350 (21%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 75/369 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.