DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or85f

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster

Alignment Length:425 Identity:77/425 - (18%)
Similarity:165/425 - (38%) Gaps:105/425 - (24%)


  Fly    16 LFFVTRYSFGLLGLRFGKEQSWLHLLWLVFNFVNLAH--CCQAEFVFGWSHLRTSPVDAMDAFCP 78
            :|::..|.  :||:  .|.:|...|.| ::.|:.||.  .|....||.....:|  :|.:.....
  Fly    18 VFWIMGYD--MLGV--PKTRSRRILYW-IYRFLCLASHGVCVGVMVFRMVEAKT--IDNVSLIMR 75

  Fly    79 LA----------CSFTTLFKLGWMWWRRQEVADL-----MDRIRLLIGEQEKREDSRRKVAQRSY 128
            .|          ..|.|:.:...:.....::|:|     :|||...:.:.         ...:|:
  Fly    76 YATLVTYIINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYHRVNDH---------YWTKSF 131

  Fly   129 -YLMVTRCG-MLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWF----- 186
             ||::...| .::..:|.|.|......:        |..|           .:.|..|:|     
  Fly   132 VYLVIIYIGSSIMVVIGPIITSIIAYFT--------HNVF-----------TYMHCYPYFLYDPE 177

  Fly   187 --PVFYLYSTWSGQVTVYAF------------AGTDGFFFGFTLYMAFLLQALRYDIQDALKPIR 237
              || ::|      :::||.            .|.|       :::.:....:....:..::.:.
  Fly   178 KDPV-WIY------ISIYALEWLHSTQMVISNIGAD-------IWLLYFQVQINLHFRGIIRSLA 228

  Fly   238 D--PSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGY 300
            |  ||::..:...:.:|.|||:...:..:..:.:||......:..::.:.||.|..:       |
  Fly   229 DHKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAV-------Y 286

  Fly   301 NIIR--------YVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLII 357
            .:|:        ||::..|....::|.||.|.::...|..:..|.|:..::......:|.:.:||
  Fly   287 TLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAYKRYLLIII 351

  Fly   358 LRAQRPITVR-VPFFAPSLPVFTSVIKFTGSIVAL 391
            :|||:|:.:. :.:.:.||..|..::..:..::.:
  Fly   352 IRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITM 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 62/364 (17%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 62/361 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52828
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.