DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or85e

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster

Alignment Length:150 Identity:30/150 - (20%)
Similarity:62/150 - (41%) Gaps:16/150 - (10%)


  Fly   247 CCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNIIRYVVYTFT 311
            |.|.|.::...:..::.:...|.  :....||.......|:  .:::.|.|.|..|...:::|  
  Fly   324 CSQELENLFSPYCLVKSLQITFQ--LCLLVFVGVSGTREVL--RIVNQLQYLGLTIFELLMFT-- 382

  Fly   312 VSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV-PFFAPSL 375
                   ||  |..:|..|:..|:|.:..||:......|:.:.:.::.::|.:.|.. .|:...:
  Fly   383 -------YC--GELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDV 438

  Fly   376 PVFTSVIKFTGSIVALAKTI 395
            ....|||....|.:.|.:.:
  Fly   439 NRLRSVITQAFSFLTLLQKL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 28/139 (20%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.