DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or85b

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster

Alignment Length:422 Identity:79/422 - (18%)
Similarity:172/422 - (40%) Gaps:87/422 - (20%)


  Fly    17 FFVTRYSFGLLGLRFGKEQSWLHLLW-LVF--NFVNLAHCCQAEFVFGWSHLRTSP-VDAMDAFC 77
            ||.|  :.|:.....|:|.....|:: :||  |.:||:.....|.::.:|....:. ::|:.|..
  Fly    10 FFYT--AVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALS 72

  Fly    78 PLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTL 142
            .:......:.|:.::.|::..:.:|::.::.:......||:   :.....|....:|..::...|
  Fly    73 YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREE---RYNLPMYLGTCSRISLIYSLL 134

  Fly   143 GSITTGAFVLRSLWEMWVRRHQEFKFD-----------MPFRMLFHDFAHRMPW--------FPV 188
            .|:....|.|..:.|.||       :|           :|:.|.       :||        :|:
  Fly   135 YSVLIWTFNLFCVMEYWV-------YDKWLNIRVVGKQLPYLMY-------IPWKWQDNWSYYPL 185

  Fly   189 FYL-----YSTWSGQVTVYAFAGTDGFFFG----FTLYMAFLLQAL-RYDIQDALKPIRDPSLRE 243
            .:.     |::.:||::      ||.....    ..::..||..:: |:::....|       ::
  Fly   186 LFSQNFAGYTSAAGQIS------TDVLLCAVATQLVMHFDFLSNSMERHELSGDWK-------KD 237

  Fly   244 SKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN------- 301
            |:.    |.|||..|..|.::....:.|...|..::|:.:|.||.        :.|:.       
  Fly   238 SRF----LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVIC--------FVGFQMTVGVPP 290

  Fly   302 --IIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPI 364
              :::..::..:..|.::|.|:.|..::..|.....|.|:..||..|...:|.:.:||.|:|:..
  Fly   291 DIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVT 355

  Fly   365 TVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395
            .::...|.. :....|.:::.:....||.:|:
  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALLRTM 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 62/357 (17%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 62/355 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52906
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.