DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or63a

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster

Alignment Length:342 Identity:72/342 - (21%)
Similarity:143/342 - (41%) Gaps:40/342 - (11%)


  Fly    84 TTLFKLGWMWWRRQEVADLMDRIRL--LIGEQEKRE---------DSRRKV-AQRSYYLMVTRCG 136
            |::.|:.:..:..:::.:|:.:.|.  |:.:.|..|         :.|::| :..:.|...||..
  Fly    86 TSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQ 150

  Fly   137 MLVFTLG--SITTGAFV---LRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYL---YS 193
            :|::...  .|||..|:   :.:|:..:.:....:...:|...|:..:.|:...||.:::   ..
  Fly   151 ILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFPYYHIQMYLE 215

  Fly   194 TWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIRDPSLR-ESKICC----QRLAD 253
            |.|..:........||.|....|:...|:::|...::.|...:..|..| |...||    ||:|:
  Fly   216 TCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVAN 280

  Fly   254 IVDRHNEIEKIVKEFSGIMAAPTFVHFVSA----SLVIATSVIDILLYSGYNIIRYVVYTFTVSS 314
            .....|...:.:          ||..|:.:    .|.:....:.:...|...:||..:|......
  Fly   281 FATEVNNCFRHI----------TFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGY 335

  Fly   315 AIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVF 378
            .|.:|||.|...:|.|..:..|.|...||...||.|..:.::::|..|...:.|.:|.. |||..
  Fly   336 QIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTL 400

  Fly   379 TSVIKFTGSIVALAKTI 395
            .::::.:|....|.:.:
  Fly   401 MAMVRTSGQYFLLLQNV 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 70/331 (21%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 70/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134646786
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.