DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or59b

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster

Alignment Length:393 Identity:82/393 - (20%)
Similarity:143/393 - (36%) Gaps:69/393 - (17%)


  Fly    37 WLHLLWL-----VFNFVNLAHCCQAEFVFGWSHLRT----SPVDAMDAFCP-------------- 78
            || :.|:     |..:|.|...| ..|.||..:|..    |.|.....|.|              
  Fly    30 WL-IGWIPPKEGVLRYVYLFWTC-VPFAFGVFYLPVGFIISYVQEFKNFTPGEFLTSLQVCINVY 92

  Fly    79 ---LACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMV---TRCGM 137
               :..:.|.||     .||.::...|:|.:...:.....||.....||:.:|..::   ..||.
  Fly    93 GASVKSTITYLF-----LWRLRKTEILLDSLDKRLANDSDRERIHNMVARCNYAFLIYSFIYCGY 152

  Fly   138 LVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMP--WFPVFYLYSTWSGQVT 200
            ...|..|.....   |..|.::          .|    |.|:...|.  |....:.|.|.|..|.
  Fly   153 AGSTFLSYALSG---RPPWSVY----------NP----FIDWRDGMGSLWIQAIFEYITMSFAVL 200

  Fly   201 VYAFAGTDGFFFGFTLYMAFLLQALRYDIQDALKPIR-DPSLRESKICCQRLADIVDRHNEIEKI 264
            ....:.|      :.|....:.:|....::|.::.:| ||...|:. ..|.|.:.|..|..|.|.
  Fly   201 QDQLSDT------YPLMFTIMFRAHMEVLKDHVRSLRMDPERSEAD-NYQDLVNCVLDHKTILKC 258

  Fly   265 VKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGY-NIIRYVVYTFTVSSAIFLYCYGGTEMST 328
            ......:::...||.|.....|:..:::::..:|.: ..:..:::..|:....|.:||....:..
  Fly   259 CDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLID 323

  Fly   329 ESLSLGEAAYSSAWYTWDRETRRRVFLIIL--RAQRPIT-VRVPFFAPSLPVFTSVIKFTGSIVA 390
            ::..|....:.|.|.  |.|.|.:..|::.  ..|:||. :....|..|:....:|.||..||:.
  Fly   324 DAQDLSNEIFQSNWV--DAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIIT 386

  Fly   391 LAK 393
            :.:
  Fly   387 IVR 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 69/344 (20%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 66/335 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51620
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.