DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or42b

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster

Alignment Length:380 Identity:79/380 - (20%)
Similarity:155/380 - (40%) Gaps:57/380 - (15%)


  Fly    37 WLHLLWLVFNFVNLAHCCQAEFVFGW-----SHLRT-SP----------VDAMDAFCPLACSFTT 85
            :::|.|.:..||    .|......|:     :.::: ||          ::|..:...:|.::: 
  Fly    43 YVYLTWTLMTFV----WCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAITYS- 102

  Fly    86 LFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMV---TRCGMLVFT-LGSIT 146
                  |.||..:..:::|::.|.....|:||.....||:.::..::   ..||....| |.|:.
  Fly   103 ------MLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTYLSSVL 161

  Fly   147 TGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWSGQVTVYAFAGTDGFF 211
            :|    |..|:::          .|| :.:||...:: |......|...||.|.....  :|.:.
  Fly   162 SG----RPPWQLY----------NPF-IDWHDGTLKL-WVASTLEYMVMSGAVLQDQL--SDSYP 208

  Fly   212 FGFTLYMAFLLQALRYDIQDALKPIR-DPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAP 275
            ..:||.:...|..||    :.::.:| |.:|.|:: ..:.|...|..|..|.:.......::...
  Fly   209 LIYTLILRAHLDMLR----ERIRRLRSDENLSEAE-SYEELVKCVMDHKLILRYCAIIKPVIQGT 268

  Fly   276 TFVHFVSASLVIATSVIDILLYSG-YNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYS 339
            .|..|:...||:..::|::..:|. :..|...::..|:....|.:||....:..:..||..|.:.
  Fly   269 IFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQ 333

  Fly   340 SAWYTWDRETRRRVFLIILRAQRPIT-VRVPFFAPSLPVFTSVIKFTGSIVALAK 393
            |.|....|..:..:...:...|:||. :....|..|:....||.||..|::.:.|
  Fly   334 SNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITK 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 71/334 (21%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 71/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51670
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.