DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or13a

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523359.2 Gene:Or13a / 32562 FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster

Alignment Length:251 Identity:56/251 - (22%)
Similarity:113/251 - (45%) Gaps:38/251 - (15%)


  Fly   171 PFRMLFHDFAHRMPW--FPVFYLYSTWSGQVTVYAFAGTD---GFFFGFTLYMAFLL-QALRYDI 229
            |::|:| .:..:..|  :.:.|::::::|...|......|   |||..:|.....|| |.:.   
  Fly   171 PYKMIF-PYDAQSSWIRYVMTYIFTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIA--- 231

  Fly   230 QDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDI 294
              .|....:..|.|| |..:||..||::||.|....|.....     |...:.|:|:|::.:|.:
  Fly   232 --GLFAGSNAELAES-IQLERLKRIVEKHNNIISFAKRLEDF-----FNPILLANLMISSVLICM 288

  Fly   295 L---LYSGYNI-----IRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDR---- 347
            :   :.:|.|:     :::::|..:..|.:::.|..|..:..:|....:..|...|...||    
  Fly   289 VGFQIVTGKNMFIGDYVKFIIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQ 353

  Fly   348 -------ETRRRVFLIILRAQRPITVRV-PFFAPSLPVFTSVIKFTGSIVALAKTI 395
                   ..|.:::.:||.:|:|:.:.. .|...||..||:::..:.|...|.:::
  Fly   354 SFTPTTKRIRNQIWFMILCSQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRSV 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 54/240 (23%)
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 54/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52850
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.