DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or46a

DIOPT Version :8

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster

Alignment Length:388 Identity:85/388 - (21%)
Similarity:154/388 - (39%) Gaps:62/388 - (15%)


  Fly    29 LRFGKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMDAFCPLACSFTTLFKLGWMW 93
            :|||.....|.::.|:|:|..|.:..|..             :.:..|...|...:.:.||..:.
  Fly    36 MRFGFILVILFIMLLLFSFEMLNNISQVR-------------EILKVFFMFATEISCMAKLLHLK 87

  Fly    94 WRRQEVADLMDRIRL----LIGEQEKREDSRRKVA----QRSYYLMVTRCGMLVF------TLGS 144
            .:.:::|.|:|.:..    :..|||.:.....:||    :.||.:|......|:.      ..|.
  Fly    88 LKSRKLAGLVDAMLSPEFGVKSEQEMQMLELDRVAVVRMRNSYGIMSLGAASLILIVPCFDNFGE 152

  Fly   145 ITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFYLYSTWSGQVTVYAFAGTDG 209
            :......:.|: |.|:....::.|            |.:...|...|..|:            |.
  Fly   153 LPLAMLEVCSI-EGWICYWSQYLF------------HSICLLPTCVLNITY------------DS 192

  Fly   210 FFFGFTLYMAFLLQALRYDIQDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAA 274
            ..:....::...||.|...: :.|.|:.:|...| ||..: |.:....:|.|.:........:..
  Fly   193 VAYSLLCFLKVQLQMLVLRL-EKLGPVIEPQDNE-KIAME-LRECAAYYNRIVRFKDLVELFIKG 254

  Fly   275 PTFVHFVSASLVIATSVIDILLYSGYN-----IIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLG 334
            |..|..:.:.||:.:::.|:...|..|     :::..:|...:...||:.||...|::.:|..|.
  Fly   255 PGSVQLMCSVLVLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLC 319

  Fly   335 EAAYSSAWYTWDRETRRRVFLIILRAQRPITVRV--PFFAPSLPVFTSVIKFTGSIVALAKTI 395
            .:.|||.|..|:|..||.|.|::.|...|:.:..  |.||.||..|.|::..:.|..||.|.:
  Fly   320 HSIYSSQWTGWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLKRV 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 72/338 (21%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 73/351 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C53063
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.