DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brp and Numa1

DIOPT Version :8

Sequence 1:NP_001246228.1 Gene:brp / 35977 FlyBaseID:FBgn0259246 Length:2238 Species:Drosophila melanogaster
Sequence 2:XP_006507232.1 Gene:Numa1 / 101706 MGIID:2443665 Length:2108 Species:Mus musculus

Alignment Length:1797 Identity:409/1798 (23%)
Similarity:721/1798 (40%) Gaps:479/1798 (27%)


  Fly   771 DYPKLPQEHKRQL-DEFRLEIQRRDQEILAMAAKMKTLEEQHQD----YQR--HIAVLKESLCAK 828
            |..:.||...|:| .:...|...||...|.::..:|.|.|:...    .||  |:|:|.|...|.
Mouse   205 DILQTPQFQMRRLKKQLADERSNRDDLELELSESLKLLTEKDAQIAMMQQRIDHLALLNEKQAAS 269

  Fly   829 EEHYNMLQTDVEEMRARLEEKNRLIEKKTQGTLQTVQERNRLTSELTELKDHMDIKDRKISVLQR 893
            .:.    .:::||:|.    ||..:..:...||:..|          .||......|||||.|..
Mouse   270 SQE----PSELEELRG----KNESLTVRLHETLKQCQ----------NLKTEKSQMDRKISQLSE 316

  Fly   894 KIENLEDLLKEKDNQVDMARARLSAMQAHHS--SSEGA------LTSLEEAIGDK----EK---- 942
            :..:|...::|..|.:...:...:.:...||  |.|.|      ...|..|:.||    ||    
Mouse   317 ENGDLSFKVREFANHLQQLQGAFNDLIEEHSKASQEWAEKQARLENELSTALQDKKCLEEKNEIL 381

  Fly   943 --QMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRAAESEVEKLQTRLERAVTERERLEIKLE 1005
              :::||.||..|.:.....|:.    ||....::|...:.|..||       .|:..:|:.::|
Mouse   382 QGKLSQLEDQATRLQESPAPEKG----EVLGDALQLDTLKQEAAKL-------ATDNTQLQTRVE 435

  Fly  1006 ASQSELGKSKAELEKATCEMGRSSADWESTKQRIARL--ELEN-----ERLKHDLERSQNVQKLM 1063
            ..:.|.||.:|:|   ..|..|    :|..||::|.|  :|::     .:.|.:||::...|...
Mouse   436 TLECERGKQEAQL---LAERSR----FEDEKQQLASLIADLQSSVSNLSQAKEELEQASQAQGAQ 493

  Fly  1064 FETGKISTTFG--RTTMTTSQELDRAQERADKASAELRRTQAELRVTQSDAERAREEAA-ALQEK 1125
            . |.::::..|  .|.....|||...:|:|.|..|::.:|..|           :|:|| .|:::
Mouse   494 L-TAQLTSMTGLNATLQQRDQELASLKEQAKKEQAQMLQTMQE-----------QEQAAQGLRQQ 546

  Fly  1126 LEKSQGEVYRLKAKLENAQGEQESLRQE-------LEKAQSGVSRIHADRDRAFSEVEKIKEEME 1183
            :|:....:...:.:||.|..|||:.||:       :.:|:....|   :||.|..::|.:::|.:
Mouse   547 VEQLSSSLKLKEQQLEEAAKEQEATRQDHAQQLAIVAEAREASLR---ERDTARQQLETVEKEKD 608

  Fly  1184 RTQATLGKSQLQ-----HEKLQNSLDKAQNEVDHLQDKLDK--ACTENRRLVLEKEKLTYDYDNL 1241
            ....:| :.|||     .:..|.|:.:||.|...|..|:.:  ||.|...  .|:.::......|
Mouse   609 AKLESL-QQQLQAANDARDNAQTSVTQAQQEKAELSQKIGELHACIEASH--QEQRQVQARVTEL 670

  Fly  1242 QSQLDKALGQAARMQK--ERETLSLDTDRIREKL----EKTQVQLGRIQKERDQFSDELETLKER 1300
            ::||      .|..||  |||.:..:..:::|:|    |..::..|.:::|:.:.:|.|:..:.|
Mouse   671 EAQL------KAEQQKTTEREKVVQEKAQLQEQLRALEESLKITKGSLEEEKRRAADALKEQQCR 729

  Fly  1301 SESAQTLLMKAARDREAMQTDLEVLKERYEKS--HAIQQKLQMERDDAVTEVEILKEKLDKALYA 1363
            :...:.........||..|.:||     .||:  ..::.::|...:....|.|.|:.:|.:|. |
Mouse   730 ATEMEAESRSLMEQREREQKELE-----QEKAGRKGLEARIQQLEEAHQAETEALRHELAEAT-A 788

  Fly  1364 SQ--------KLIDEKDTSNKEFEKMLEKYDR----AQNEIYRLQSRCDTAEADRARLEVEAE-- 1414
            ||        :||.|.::..|.||...::..|    .|.::..|:......|.....:|:.:|  
Mouse   789 SQHRAESECERLIREVESRQKRFEARQQEEARYGAMFQEQLMALKGEKTGQEVQEEAVEIHSEGQ 853

  Fly  1415 ----RSGLA---ASKAREDLRKLQDESTRLQEAC-DRAALQLSRAKECEDNARSELEHSRDRFDK 1471
                :|.||   ||.|:. ::::|::..|.|:.. |.:|||...|...::.|            .
Mouse   854 PGQQQSQLAQLHASLAKA-IQQVQEKEVRAQKLVDDLSALQEKMAATNKEVA------------C 905

  Fly  1472 LQTDIRRAQGEKEHFQSELERVTYELERAHAAQTKAS---------------ASVEAAKEEAAHY 1521
            |:|.:.:|..::|....||      |:....|..:||               |:|:|.:.||...
Mouse   906 LKTLVLKAGEQQETASLEL------LKEPPRAANRASDQLGEQQGRPFSSTHAAVKAMEREAEQM 964

  Fly  1522 AVELEKMRDRYEKS---QVELRKLQDTDTFGRETRRLKEENERLREKLDKTLMELETIRGKSQYE 1583
            ..|||::|....||   |.|.|..|:     ||..||.:|                  ||::|.:
Mouse   965 GGELERLRAALIKSQGQQQEERGQQE-----REVARLTQE------------------RGQAQAD 1006

  Fly  1584 SESFEKYKDKYEKIEMEVQNMESKLHETSLQLELSKGEVAKMLANQEKQRSELERAHIEREKARD 1648
            ..     ::|..|.|:|:: :::.|:|..::....:..:|..|..:|....||.:...:....|.
Mouse  1007 LA-----QEKAAKAELEMR-LQNTLNEQRVEFAALQEALAHALTEKEGTDQELAKLRGQEAAQRT 1065

  Fly  1649 KHEKLLKEVDRLRLQQSSVSPGDPV------RASTSSSSALSAGERQ----EIDRLRDRLEKALQ 1703
            :.::|.:.:::|::|........|.      .||...:.:.:||:..    |:..||..:.|..|
Mouse  1066 ELKELQQTLEQLKIQLVKKEKEHPAGGASGEDASGPGTQSETAGKTDAPGPELQALRAEISKLEQ 1130

  Fly  1704 SRDATELEAGRLAKELEKAQMHLAKQQENTESTRIEFERMGAELGRLHDRLEKAEAERE--ALRQ 1766
            .....:.:...|...|:..:...|:|.:..|:.:.:.|....|||  |::...|.|:||  ||| 
Mouse  1131 QCQQQQQQVEGLTHSLKSERACRAEQDKALETLQGQLEEKARELG--HNQAASASAQRELQALR- 1192

  Fly  1767 ANRSGGAGAAPHPQLEKH------------------VQKLESDVKQL---AMERE--------QL 1802
                  |.|..|.:.|:.                  :..||.:|..|   .:|:|        .:
Mouse  1193 ------AKAQDHSKAEEEWKAQVARGQQEAERKSSLISSLEEEVSILNRQVLEKEGESKELKRLV 1251

  Fly  1803 VLQLEKSQEI-----LMNFQKELQNAEA---------ELQKTREENRKLR----NGHQVPPVAAP 1849
            |.:.||||::     |:..:....:|.|         |:|..|||..|.|    |..|.....|.
Mouse  1252 VAESEKSQKLEERLRLLQVETASNSARAAERSSALREEVQSLREEVEKQRVVSENSRQELASQAE 1316

  Fly  1850 PAGPSPAEFQAMQKEIQTLQQKLQESERALQAAGPQ---------------------QAQAAAAA 1893
            .|       :.:.:|::..|:|..:.|:||.|...:                     ||:.|||.
Mouse  1317 RA-------EELGQELKAWQEKFFQKEQALSALQLEHTSTQALVSELLPAKHLCQQLQAEQAAAE 1374

  Fly  1894 GASREEIEQWR-------------------------KVIEQEKS----RADMADKAAQ-----EM 1924
            ...|||:||.:                         |::|||::    ||:.|..|.|     :.
Mouse  1375 KRFREELEQSKQAAGGLQAELMRAQRELGELGSLRQKIVEQERAAQQLRAEKASYAEQLSMLKKA 1439

  Fly  1925 H-----------KRIQLMDQHIKDQHAQ-MQKMQQQMQQQQQAAQQAVQQAAQQQQSAAGAGGAD 1977
            |           :|..|..|.::.:..| .:|..|::...:..|:..:.:..|:.||.:      
Mouse  1440 HGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRTDAETHLAEMRQEAQSTS------ 1498

  Fly  1978 PKELE----KVRGELQAACTERDRFQQQLELLVTELEKSKMSNQEQAKQLQ-------------- 2024
             :|||    |..|.......||.|||::.:.|..::|:.::..:||.||::              
Mouse  1499 -RELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLTEHDQASK 1562

  Fly  2025 --------------TAQQQVQQLQQQVQQLQQQMQQLQQA----------ASAGAGATDVQRQQL 2065
                          .:||:||:||.|:.:||.|:.|.:||          |.....|...|.|:|
Mouse  1563 VQQQKLKAFQAQRGESQQEVQRLQTQLNELQAQLSQKEQAAEHYKLQMEKAKTHYDAKKQQNQKL 1627

  Fly  2066 EQQQKQLEEVRKQIDNQAKATEGERKIIDEQRKQIDAKRKDIEEK-----------EKKMAEFDV 2119
            ::|.:.|||::|  :|:...:|.||  :..:.:|...|.|:.|:.           |.::|..|.
Mouse  1628 QEQLQDLEELQK--ENKELRSEAER--LGRELQQAGLKTKEAEQTCRHLTAQVRSLEAQVAHADQ 1688

  Fly  2120 QLR------------KRKE---------QMDQLEKSLQ-------------TQGGGAAAAGE--- 2147
            |||            |.:|         .:|.|:.||:             ||..|.:..||   
Mouse  1689 QLRDLGKFQVATDALKSREPQVKPQLDLSIDSLDLSLEEGTPCSVASKLPRTQPDGTSVPGEPAS 1753

  Fly  2148 -LNKKLMDT----------------QRQLEACVKELQNT-KEEHKKAATETERLLQLVQMSQ--- 2191
             ::::|...                |..||..:..|.:. .:..:|..:...|..|::.::.   
Mouse  1754 PISQRLPPKVESLESLYFTPTPARGQAPLETSLDSLGDAFPDSGRKTRSARRRTTQIINITMTKK 1818

  Fly  2192 ---EEQNAKEKTIMDLQQALKIAQAKVKQAQTQQQQQQDAGP 2230
               ||.::...:....|.| ..:||.::...:.|...:...|
Mouse  1819 LELEEPDSANSSFYSTQSA-PASQANLRATSSTQSLARLGSP 1859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
brpNP_001246228.1 KRTAP 332..401 CDD:256601
Myosin_tail_1 789..1824 CDD:279860 275/1177 (23%)
SMC_prok_B 1509..>2215 CDD:274008 209/949 (22%)
Bud13 2091..>2157 CDD:286779 23/131 (18%)
Numa1XP_006507232.1 SMC_prok_B <207..>907 CDD:274008 188/779 (24%)
Myosin_tail_1 653..1690 CDD:279860 254/1126 (23%)
GBP_C <1520..1657 CDD:303769 36/141 (26%)
coiled coil 1633..1644 CDD:293879 5/13 (38%)
coiled coil 1648..1657 CDD:293879 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.