DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13955 and tchp

Sequence 1:NP_610486.1 Gene:CG13955 FlyBaseID:FBgn0033412 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001035433.1 Gene:tchp ZFINID:ZDB-GENE-060421-3368 Length:499 Species:Danio rerio

Alignment Length:375 Identity:93/376 (25%)
Similarity:164/376 (44%) Gaps:102/376 (27%)


  Fly     5 EFLTRTD---------RRNLKSQI--------SFQVAQKMHEWHADLDNRRWNLCLLLQKEALEA 52
            :.:.:||         |:||..::        :.|:.:...|.|.|....:|.   :.|:|..:|
Zfish   116 QLVEKTDALRSAREERRKNLAQELLREHWKQNNSQLRKVESELHKDHIVSQWQ---VQQQEKKQA 177

  Fly    53 DEQIAEMLQAQADEADRKRHEWIEMERLKREE----------AEMELVKVKKQQREIENSEAHRH 107
            ||:..|..|...:|.:|.|.|  .:||:::||          || ||:| :.::.::...||.|.
Zfish   178 DERTQEEKQRFENEYERTRQE--ALERMRKEEENRKWEEKKRAE-ELLK-QMEELKLREQEAERL 238

  Fly   108 MLTKEILLESKQAQLHQIEEKKAL---KRRQACVEILWQRVWQRLDESKAQQEQHELK-----LR 164
            ...:|.|: ||:.:|.::|:::.:   .||:........|.::...:.:|||.|.||:     |.
Zfish   239 KQEQETLM-SKRWELEKLEDERKMMEESRRKTEFGRFLTRQYRAQLKRRAQQVQEELEADRKILA 302

  Fly   165 NLIENRCQAHNLDTDREQKAQ---------FAKEVLADQRECSQALELAAEMDVLKKQEDLKKLK 220
            .|:|.     .||..|..||:         :.|.|:.:|.:..:  |..||.|:|.: |:.:::.
Zfish   303 ALLEG-----ELDEQRFHKARRERAVADAAWMKRVIEEQLQLER--EREAEFDILYR-EEAQRVW 359

  Fly   221 DKR---------------------RQQLIDLQDQIKWNLTISARQAQANIREDVGYNILEDR--- 261
            :||                     |||  .||::::.|..  ||:.....||::...:.:||   
Zfish   360 EKREAEWEKERRARERLMREVLAGRQQ--QLQERMQENRL--AREESLQRREELLQQLEQDRLTL 420

  Fly   262 QIYEELME-KRCARIHNRD----------WHQQYMTHTAAERAARREEDL 300
            ::.:|..| .|.|||...|          |.||   .|..:..|:..|:|
Zfish   421 RLEKEQQEGLRTARIQEIDNQVEQRRKEQWEQQ---QTLEQEEAQEREEL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13955NP_610486.1 None
tchpNP_001035433.1 Interaction with keratin proteins. {ECO:0000250|UniProtKB:Q9BT92} 74..499 93/376 (25%)
TPH 151..484 CDD:290579 87/341 (26%)
Trichohyalin/plectin homology domain. {ECO:0000250|UniProtKB:Q9BT92} 260..426 41/178 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.