DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and SDS22

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae

Alignment Length:228 Identity:61/229 (27%)
Similarity:103/229 (45%) Gaps:59/229 (26%)


  Fly     1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMD--STLGT----------------- 46
            ::|.|::..:..:.:..:...:|| .:.:|.|....|.|::  |||.:                 
Yeast   112 LTKLTSLDLSFNKIKHIKNLENLT-DLENLYFVQNSISKIENLSTLKSLKNLELGGNKVHSIEPD 175

  Fly    47 ----LVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEK 107
                |...|.|.:..|.|.::..|..:|.||:||:..|.:|:|..||.:. .||||:||:|.|.|
Yeast   176 SFEGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELT-NLEELYLSHNFITK 239

  Fly   108 IKGL----------------TGLKCLKVLYISNNLIKDWSEFNR-----------LAEIESLEDL 145
            |:||                |.|:.|..|   :||...|:.||:           |:.:..||.:
Yeast   240 IEGLEKNLKLTTLDVTSNKITSLENLNHL---SNLTDIWASFNKIDQSFESLGENLSALSRLETI 301

  Fly   146 VVVGNPLSEGLDEPT-WRAECIKRL-PTIRKLD 176
            .:.|||:.  |:..| :|.:....| |:::|:|
Yeast   302 YLEGNPIQ--LENKTSYRRKLTMNLPPSLQKID 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 59/216 (27%)
leucine-rich repeat 50..71 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 14/37 (38%)
leucine-rich repeat 117..141 CDD:275380 8/35 (23%)
SDS22NP_012728.1 leucine-rich repeat 44..67 CDD:275380
LRR <59..338 CDD:227223 61/229 (27%)
leucine-rich repeat 68..91 CDD:275380
leucine-rich repeat 92..114 CDD:275380 0/2 (0%)
leucine-rich repeat 115..136 CDD:275380 3/22 (14%)
leucine-rich repeat 137..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..182 CDD:275380 1/23 (4%)
leucine-rich repeat 183..204 CDD:275380 6/21 (29%)
leucine-rich repeat 205..248 CDD:275380 21/44 (48%)
leucine-rich repeat 249..270 CDD:275380 4/24 (17%)
leucine-rich repeat 271..294 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.