DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and DRC3

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_011522320.1 Gene:DRC3 HGNCID:25384 Length:562 Species:Homo sapiens

Alignment Length:178 Identity:55/179 (31%)
Similarity:79/179 (44%) Gaps:23/179 (13%)


  Fly    18 EQQNSLTAKVIDLQFQW-------PPIEKMDS---------TLGTLVQCE---RISMSTNMIEKI 63
            :|:..|...|:.||..:       |..|:.|.         .:..|.|.|   ::.:..|:||||
Human    36 KQEGILFKDVLSLQLDFRRKTADEPKGEQDDGQEDSQEDILRIDNLWQFENLRKLQLDNNIIEKI 100

  Fly    64 FGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIK 128
            .||..:..|..|.||.|.|:.|.||:.:. .||:|.|..|.|.||..|..|..|:||.:.||.|.
Human   101 EGLENLAHLVWLDLSFNNIETIEGLDTLV-NLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRID 164

  Fly   129 DWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            :......|...:.|..|.:..||:||..|   ::......||.:..||
Human   165 NMMNIIYLRRFKCLRTLSLSRNPISEAED---YKMFICAYLPDLMYLD 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 55/179 (31%)
leucine-rich repeat 50..71 CDD:275380 8/24 (33%)
leucine-rich repeat 95..116 CDD:275380 10/21 (48%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
DRC3XP_011522320.1 leucine-rich repeat 87..108 CDD:275378 7/21 (33%)
LRR_9 88..213 CDD:317038 44/127 (35%)
leucine-rich repeat 109..130 CDD:275378 9/22 (41%)
leucine-rich repeat 131..152 CDD:275378 10/21 (48%)
leucine-rich repeat 153..177 CDD:275378 7/24 (29%)
leucine-rich repeat 178..189 CDD:275378 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.