DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and CEP97

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_078824.2 Gene:CEP97 HGNCID:26244 Length:865 Species:Homo sapiens

Alignment Length:188 Identity:43/189 (23%)
Similarity:75/189 (40%) Gaps:61/189 (32%)


  Fly    44 LGTLVQCER---ISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAE------------ 93
            |..|.:|:|   :|::.|.:.::.|::.:..|:||:|..|.|..:.||:.:..            
Human    51 LENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLK 115

  Fly    94 ---------TLEELWLSYNLIEKIKGLTGLKCLKVLYISNNL----------------------- 126
                     .|:.|.||.|.|.:|..|:.|..||.|.:..|:                       
Human   116 AMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAEN 180

  Fly   127 -IKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLN 183
             |:|.:|.:.||.:..||.|.::.||             |:...|:|...|..|.:::
Human   181 EIRDLNEISFLASLTELEQLSIMNNP-------------CVMATPSIPGFDYRPYIVS 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 43/189 (23%)
leucine-rich repeat 50..71 CDD:275380 5/24 (21%)
leucine-rich repeat 95..116 CDD:275380 9/21 (43%)
leucine-rich repeat 117..141 CDD:275380 9/48 (19%)
CEP97NP_078824.2 leucine-rich repeat 17..37 CDD:275380
LRR 1 37..58 3/7 (43%)
leucine-rich repeat 38..59 CDD:275380 3/8 (38%)
LRR 2 59..80 4/21 (19%)
leucine-rich repeat 60..81 CDD:275380 3/21 (14%)
LRR_8 63..114 CDD:290566 11/51 (22%)
LRR_RI <78..200 CDD:238064 28/122 (23%)
LRR 3 81..102 8/21 (38%)
leucine-rich repeat 82..103 CDD:275380 8/21 (38%)
LRR_8 103..156 CDD:290566 12/53 (23%)
LRR 4 103..124 0/21 (0%)
leucine-rich repeat 104..125 CDD:275380 0/21 (0%)
LRR_4 124..161 CDD:289563 13/37 (35%)
LRR 5 125..146 9/21 (43%)
leucine-rich repeat 126..147 CDD:275380 9/21 (43%)
LRR_8 147..206 CDD:290566 13/59 (22%)
LRR 6 147..168 4/21 (19%)
leucine-rich repeat 148..171 CDD:275380 4/23 (17%)
LRR 7 171..192 4/21 (19%)
leucine-rich repeat 172..196 CDD:275380 5/24 (21%)
LRR 8 196..205 3/9 (33%)
CCP110-binding 300..750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.