DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc9

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006516438.1 Gene:Lrrc9 MGIID:1925507 Length:1457 Species:Mus musculus

Alignment Length:163 Identity:52/164 (32%)
Similarity:83/164 (51%) Gaps:32/164 (20%)


  Fly    42 STLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIE 106
            |.|.|.:|.:.:.::...||||.||.|.:.|:.|.|..|.|.:|..||.:.: ||.|||::|:|:
Mouse    70 SGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLYLYYNKISKIENLEKLIK-LEVLWLNHNMIK 133

  Fly   107 KIKGLTGLKCLKVLYISNNLIKDWSEFNR-LAEIESLEDLVVVGNPLSE---------------- 154
            .|:||..||.||.|.::.||:   |...| |...|.||.|.:.||.::.                
Mouse   134 NIEGLQTLKNLKDLNLAGNLV---SSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDL 195

  Fly   155 GLDEPTWRAE-----C------IKRLPTIRKLD 176
            .|::|.:::.     |      :..||::::||
Mouse   196 CLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 52/164 (32%)
leucine-rich repeat 50..71 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 12/21 (57%)
leucine-rich repeat 117..141 CDD:275380 9/25 (36%)
Lrrc9XP_006516438.1 leucine-rich repeat 47..77 CDD:275380 3/7 (43%)
LRR_4 77..118 CDD:289563 16/41 (39%)
leucine-rich repeat 78..99 CDD:275380 7/21 (33%)
LRR_4 99..139 CDD:289563 18/41 (44%)
leucine-rich repeat 100..121 CDD:275380 8/21 (38%)
LRR_8 121..177 CDD:290566 26/60 (43%)
leucine-rich repeat 122..143 CDD:275380 12/21 (57%)
LRR_4 142..185 CDD:289563 15/46 (33%)
leucine-rich repeat 144..166 CDD:275380 9/25 (36%)
leucine-rich repeat 167..191 CDD:275380 5/24 (21%)
leucine-rich repeat 192..223 CDD:275380 5/31 (16%)
leucine-rich repeat 689..708 CDD:275380
LRR_8 707..763 CDD:290566
leucine-rich repeat 709..730 CDD:275380
LRR_4 730..765 CDD:289563
leucine-rich repeat 731..752 CDD:275380
leucine-rich repeat 753..779 CDD:275380
leucine-rich repeat 780..806 CDD:275380
leucine-rich repeat 807..865 CDD:275380
leucine-rich repeat 866..901 CDD:275380
LRR_4 900..941 CDD:289563
leucine-rich repeat 902..923 CDD:275380
LRR_9 <924..1068 CDD:258718
leucine-rich repeat 924..945 CDD:275380
leucine-rich repeat 946..969 CDD:275380
leucine-rich repeat 992..1016 CDD:275380
leucine-rich repeat 1017..1044 CDD:275380
leucine-rich repeat 1132..1157 CDD:275380
leucine-rich repeat 1158..1194 CDD:275380
leucine-rich repeat 1195..1218 CDD:275380
leucine-rich repeat 1219..1240 CDD:275380
LRR_8 1241..1297 CDD:290566
leucine-rich repeat 1241..1264 CDD:275380
LRR_4 1264..1305 CDD:289563
leucine-rich repeat 1265..1286 CDD:275380
leucine-rich repeat 1287..1311 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.