DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrrcc1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_012820393.1 Gene:lrrcc1 XenbaseID:XB-GENE-992687 Length:1062 Species:Xenopus tropicalis

Alignment Length:170 Identity:51/171 (30%)
Similarity:80/171 (47%) Gaps:35/171 (20%)


  Fly    37 IEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLS 101
            |.|::. ||.|...:.:.:|:|:|.||.||..:.||:.|:||.|.:..:.||..:. .|::|.||
 Frog    40 ISKIEG-LGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLF-NLKKLNLS 102

  Fly   102 YNLIEKIKGLTGL----KCLKVLYISNNLIKDWSEFNRLAEIESLEDLV-------------VVG 149
            ||.|:.:.|...|    ..|..||:.:|.|      |.:.|:  |:.:|             ..|
 Frog   103 YNRIQDLTGFIPLHGRNHKLSHLYLHSNCI------NNIEEV--LQSMVGLNCLLHLTLEQNAKG 159

  Fly   150 NPLSEGLDEPTWRAECIKRLPTIRKLD-----GEPVVLNE 184
            ||:...|.   :|...::.||.:..||     |.||..:|
 Frog   160 NPVCNVLG---YREIILENLPQLNSLDGIDRSGVPVTAHE 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 50/169 (30%)
leucine-rich repeat 50..71 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 9/25 (36%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
lrrcc1XP_012820393.1 leucine-rich repeat 9..29 CDD:275380
LRR_8 28..84 CDD:290566 18/45 (40%)
leucine-rich repeat 30..51 CDD:275380 5/12 (42%)
LRR_4 52..85 CDD:289563 13/33 (39%)
leucine-rich repeat 52..73 CDD:275380 7/21 (33%)
LRR_4 72..112 CDD:289563 16/41 (39%)
leucine-rich repeat 74..95 CDD:275380 7/22 (32%)
LRR_8 95..156 CDD:290566 18/69 (26%)
LRR_4 95..138 CDD:289563 16/49 (33%)
leucine-rich repeat 96..121 CDD:275380 9/25 (36%)
SMC_prok_B 432..>1059 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.