DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrrc9

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_017951824.1 Gene:lrrc9 XenbaseID:XB-GENE-1011352 Length:1514 Species:Xenopus tropicalis

Alignment Length:141 Identity:45/142 (32%)
Similarity:68/142 (48%) Gaps:16/142 (11%)


  Fly    44 LGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAET-------LEELWLS 101
            ||.|...:.:.:..|.|..:.||..::.|:.|.|..|.||      |:|||       |..|.|.
 Frog  1230 LGRLRNLKSLYLQGNEISHVEGLENLQFLRELVLDHNRIK------AIAETSFAKLNSLVSLNLE 1288

  Fly   102 YNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECI 166
            .|.:..:..|..|..|:.|.|.:|.|::.||..:|..|.:|.:|.:.|||:|.   :|..|...:
 Frog  1289 ENRLRDLNNLPPLLKLRKLLIGSNKIQEISEIEKLEVIPALVELSISGNPISR---KPFLRNLLV 1350

  Fly   167 KRLPTIRKLDG 177
            .||..::.|||
 Frog  1351 VRLQNLQILDG 1361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 45/142 (32%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 6/21 (29%)
leucine-rich repeat 117..141 CDD:275380 9/24 (38%)
lrrc9XP_017951824.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.