DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and drc3

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_021327254.1 Gene:drc3 ZFINID:ZDB-GENE-061103-349 Length:514 Species:Danio rerio

Alignment Length:175 Identity:53/176 (30%)
Similarity:83/176 (47%) Gaps:10/176 (6%)


  Fly     7 IKEALKRWEEREQQNSLT-----AKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGL 66
            |.|.:.:....|||...|     .:|::|:..:..|.|: ..|.:.....::.:..|.||:|.||
Zfish    12 IDEQMLQRAVEEQQTRYTEGIQLEEVLELRLDYRNILKI-YHLWSFSSLTKLQLDNNAIERIEGL 75

  Fly    67 SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWS 131
            ..:..|..|.||.|.|:.|.||:.:.: |::|.|..|.|..|:.|..|:.|:||.:.||.|....
Zfish    76 ENLTNLTWLDLSFNKIEVIEGLQTLVK-LQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLE 139

  Fly   132 EFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            ....|...:||..|.:.|||:.|   |..::......||.:..||
Zfish   140 NVIYLRRFQSLRTLNLAGNPICE---EDRYKTFVSAYLPELVYLD 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 51/169 (30%)
leucine-rich repeat 50..71 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 8/21 (38%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
drc3XP_021327254.1 leucine-rich repeat 39..58 CDD:275380 4/20 (20%)
leucine-rich repeat 59..80 CDD:275378 6/21 (29%)
LRR_9 61..198 CDD:317038 42/126 (33%)
leucine-rich repeat 81..102 CDD:275378 9/21 (43%)
leucine-rich repeat 103..124 CDD:275378 8/21 (38%)
leucine-rich repeat 125..149 CDD:275378 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.