DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Dnal1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006240414.1 Gene:Dnal1 RGDID:1591349 Length:249 Species:Rattus norvegicus

Alignment Length:187 Identity:109/188 (58%)
Similarity:140/188 (74%) Gaps:1/188 (1%)


  Fly     2 SKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGL 66
            :|||||||||.||||:..|....|:.|.|..|.|||||||::|.||..||::|:|||.||||..|
  Rat    61 AKATTIKEALSRWEEKTGQKPSDAREIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCIEKIANL 125

  Fly    67 SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWS 131
            :|:|.|::|||.||.||.::|||||.:||||||:|||.|||:||:..::.||:|||||||:|||:
  Rat   126 NGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMRKLKILYISNNLVKDWA 190

  Fly   132 EFNRLAEIESLEDLVVVGNPLSEGLD-EPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            ||.:|||:..|||||.|||||.|... |..|..|..||:|.::||||.||:..:|.:
  Rat   191 EFVKLAELPCLEDLVFVGNPLEEKHSAEGNWIEEATKRVPKLKKLDGTPVIKEDEEE 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 98/171 (57%)
leucine-rich repeat 50..71 CDD:275380 13/21 (62%)
leucine-rich repeat 95..116 CDD:275380 13/21 (62%)
leucine-rich repeat 117..141 CDD:275380 17/24 (71%)
Dnal1XP_006240414.1 LRR_4 108..148 CDD:289563 23/40 (58%)
leucine-rich repeat 109..129 CDD:275378 12/20 (60%)
LRR_8 129..186 CDD:290566 37/57 (65%)
leucine-rich repeat 131..175 CDD:275382 27/44 (61%)
LRR_4 154..192 CDD:289563 26/38 (68%)
leucine-rich repeat 176..199 CDD:275382 17/23 (74%)
leucine-rich repeat 201..231 CDD:275382 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158733022
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 1 1.000
Homologene 1 1.000 H34623
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1395642at2759
OrthoFinder 1 1.000 FOG0007569
OrthoInspector 1 1.000 T617356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15454
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.