DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Ppp1r7

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_075689.1 Gene:Ppp1r7 MGIID:1913635 Length:361 Species:Mus musculus

Alignment Length:162 Identity:48/163 (29%)
Similarity:82/163 (50%) Gaps:30/163 (18%)


  Fly    37 IEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLS 101
            ||.:|    ||...|.:.:..|.|.|:..|..:..|.|||:..|.:.:|.||:::. .|.||:||
Mouse   202 IENID----TLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLV-NLRELYLS 261

  Fly   102 YNLIEKIKGL----------------------TGLKCLKVLYISNNLIKDWSEFNRLAEIESLED 144
            .|.||.|:||                      :.|..|:..::::||::.||:.:.|....|||.
Mouse   262 NNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLET 326

  Fly   145 LVVVGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            :.:..|||.:   :|.:|.:.:..||::|::|
Mouse   327 VYLERNPLQK---DPQYRRKVMLALPSVRQID 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 48/163 (29%)
leucine-rich repeat 50..71 CDD:275380 5/21 (24%)
leucine-rich repeat 95..116 CDD:275380 12/43 (28%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
Ppp1r7NP_075689.1 LRR 1 78..99
LRR_4 99..140 CDD:289563
LRR 2 100..121
leucine-rich repeat 101..122 CDD:275380
LRR_4 121..163 CDD:289563
LRR_8 122..177 CDD:290566
LRR 3 122..143
leucine-rich repeat 123..144 CDD:275380
LRR_4 143..185 CDD:289563
LRR 4 144..165
leucine-rich repeat 145..166 CDD:275380
LRR_8 165..221 CDD:290566 7/23 (30%)
LRR 5 166..187
leucine-rich repeat 167..188 CDD:275380
LRR_4 188..227 CDD:289563 9/29 (31%)
LRR 6 188..209 5/11 (45%)
leucine-rich repeat 189..210 CDD:275380 5/12 (42%)
LRR_4 209..251 CDD:289563 13/42 (31%)
LRR 7 210..231 5/21 (24%)
leucine-rich repeat 211..232 CDD:275380 5/21 (24%)
LRR_8 231..287 CDD:290566 19/57 (33%)
LRR 8 232..253 8/21 (38%)
leucine-rich repeat 233..254 CDD:275380 8/22 (36%)
LRR_4 254..295 CDD:289563 11/41 (27%)
LRR 9 254..275 11/21 (52%)
leucine-rich repeat 255..276 CDD:275380 11/21 (52%)
LRR_4 276..317 CDD:289563 6/41 (15%)
LRR 10 276..297 1/21 (5%)
leucine-rich repeat 277..298 CDD:275380 1/21 (5%)
LRR 11 298..319 6/21 (29%)
LRRcap 337..355 CDD:197729 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.