DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrriq1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_009291864.1 Gene:lrriq1 ZFINID:ZDB-GENE-050419-235 Length:1511 Species:Danio rerio

Alignment Length:185 Identity:48/186 (26%)
Similarity:73/186 (39%) Gaps:49/186 (26%)


  Fly    42 STLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLE--AVAETLE-------- 96
            |.||.|.....:|:..|.:....||..:..|..|..|.||:..:.|||  |:..||:        
Zfish   793 SGLGALKMLLHLSVDHNQLLSTRGLKEIYTLLHLDCSYNYLSHVEGLENCALLNTLDLKGNSLTE 857

  Fly    97 -----------ELWLSYNLIEKIKGLTG------------------------LKCLKVLYISNNL 126
                       :|:|..|||..:..|..                        |..||.|.:|:|.
Zfish   858 LPVLQNHVLLRDLYLDDNLIPSLDDLKSYWLPLLQNLSVVQNSITHLSPLLDLVSLKTLDVSHNC 922

  Fly   127 IKDWSEF-NRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV 180
            :.|..:. ..|.|..||::|.:..|||   |.|..||:..::.:|.:.||:.|.:
Zfish   923 LSDLQDLCLNLQECSSLQELSLTVNPL---LQENNWRSLILETVPGLIKLNNEQI 974

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 48/186 (26%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 8/64 (13%)
leucine-rich repeat 117..141 CDD:275380 8/25 (32%)
lrriq1XP_009291864.1 LRR_RI 713..952 CDD:238064 41/162 (25%)
LRR_8 713..767 CDD:290566
leucine-rich repeat 714..735 CDD:275380
leucine-rich repeat 736..756 CDD:275380
LRR_8 755..811 CDD:290566 6/18 (33%)
leucine-rich repeat 757..778 CDD:275380
leucine-rich repeat 779..800 CDD:275380 4/7 (57%)
leucine-rich repeat 801..822 CDD:275380 4/21 (19%)
leucine-rich repeat 823..844 CDD:275380 9/21 (43%)
leucine-rich repeat 845..866 CDD:275380 2/21 (10%)
LRR_8 867..921 CDD:290566 11/54 (20%)
leucine-rich repeat 867..890 CDD:275380 6/23 (26%)
leucine-rich repeat 891..912 CDD:275380 1/21 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.