DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrrc23

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_012822059.1 Gene:lrrc23 XenbaseID:XB-GENE-877189 Length:354 Species:Xenopus tropicalis

Alignment Length:164 Identity:45/165 (27%)
Similarity:79/165 (48%) Gaps:18/165 (11%)


  Fly    26 KVIDLQ-FQWPPIEKMDSTLGTL-----VQCERIS------MSTNMIEKIFGLSGMKCLKVLSLS 78
            ::..|| |..|.:|.::.....|     ::|..:|      :.:|.:....||: :..|:.|.|.
 Frog   164 RIKSLQGFGHPRLETLNLIGNELRDLEGLECSNLSSLHTLELRSNQLLSTAGLN-LPSLRELYLG 227

  Fly    79 RNYIKQISGLEAVAETLEELWLSYNLIEKIKGLT-GLKCLKVLYISNNLIKDWSEFNRLAEIESL 142
            :|.|.::.||||:. .|..|.|..|.:|.:.|.: .|:.|:.|.:.:|::....|..:|..:..|
 Frog   228 QNNISRLEGLEALV-NLTTLHLRDNQLESLDGFSEHLQALQYLNLRSNMVAKLQEVQKLYCLPRL 291

  Fly   143 EDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLD 176
            ..||:..||..|   |..:|.|.:..||.:.:||
 Frog   292 RALVLRENPCEE---EEGYRMETLIALPQLERLD 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 45/165 (27%)
leucine-rich repeat 50..71 CDD:275380 5/27 (19%)
leucine-rich repeat 95..116 CDD:275380 7/22 (32%)
leucine-rich repeat 117..141 CDD:275380 5/24 (21%)
lrrc23XP_012822059.1 LRR_4 110..149 CDD:289563
leucine-rich repeat 111..132 CDD:275380
leucine-rich repeat 133..154 CDD:275380
leucine-rich repeat 155..175 CDD:275380 4/11 (36%)
leucine-rich repeat 176..199 CDD:275380 4/23 (17%)
LRR_8 198..253 CDD:290566 17/57 (30%)
leucine-rich repeat 200..220 CDD:275380 3/21 (14%)
LRR_4 219..261 CDD:289563 15/43 (35%)
leucine-rich repeat 221..242 CDD:275380 9/22 (41%)
LRR_8 242..300 CDD:290566 16/58 (28%)
LRR_4 242..284 CDD:289563 11/42 (26%)
leucine-rich repeat 243..265 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.