DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and dnal1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_012823845.1 Gene:dnal1 XenbaseID:XB-GENE-983792 Length:201 Species:Xenopus tropicalis

Alignment Length:187 Identity:113/188 (60%)
Similarity:144/188 (77%) Gaps:1/188 (1%)


  Fly     2 SKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGL 66
            :|||||||||.:||||..|.:..||.:.|..|.|||||||::|.|||.||::|:|||.||||..|
 Frog    11 AKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANL 75

  Fly    67 SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWS 131
            :|:|.|::|||.||.||.::|||||.|||||||:|||||||:||:..:|.|||||:||||:|||:
 Frog    76 NGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWA 140

  Fly   132 EFNRLAEIESLEDLVVVGNPLSE-GLDEPTWRAECIKRLPTIRKLDGEPVVLNEEPQ 187
            ||::|.|:..|||:|.|||||.| ...|..|..|.:||||.::||||.||:..||.:
 Frog   141 EFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIKQEEEE 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 102/171 (60%)
leucine-rich repeat 50..71 CDD:275380 13/21 (62%)
leucine-rich repeat 95..116 CDD:275380 15/21 (71%)
leucine-rich repeat 117..141 CDD:275380 16/24 (67%)
dnal1XP_012823845.1 LRR_4 58..98 CDD:289563 23/40 (58%)
leucine-rich repeat 59..80 CDD:275378 13/21 (62%)
LRR_8 81..136 CDD:290566 39/55 (71%)
leucine-rich repeat 81..99 CDD:275378 11/18 (61%)
LRR_4 104..144 CDD:289563 29/40 (73%)
leucine-rich repeat 104..125 CDD:275382 15/21 (71%)
leucine-rich repeat 126..149 CDD:275382 16/23 (70%)
leucine-rich repeat 151..181 CDD:275382 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158731152
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 1 1.000
Homologene 1 1.000 H34623
Inparanoid 1 1.050 229 1.000 Inparanoid score I3250
OMA 1 1.010
OrthoDB 1 1.010 D1395642at2759
OrthoFinder 1 1.000 FOG0007569
OrthoInspector 1 1.000 T1058288
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4855
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.