DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and LRRC49

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001185946.1 Gene:LRRC49 HGNCID:25965 Length:691 Species:Homo sapiens

Alignment Length:217 Identity:53/218 (24%)
Similarity:95/218 (44%) Gaps:54/218 (25%)


  Fly    18 EQQNSLTAKVID-------LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVL 75
            |:|......:|:       |.||...|.::.: :..|.:...:.:..|.||:|.|||.::||:||
Human   103 ERQKLTVCPIINGEDHLRLLNFQHNFITRIQN-ISNLQKLISLDLYDNQIEEISGLSTLRCLRVL 166

  Fly    76 SLSRNYIKQISGLEAV-------------------------------------------AETLEE 97
            .|.:|.||:||.||.:                                           .::|.|
Human   167 LLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTE 231

  Fly    98 LWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWR 162
            |.|.:|.|..::.:..|.||:.|::|.|.|..:...:.||:..||.|:...|||:::   |..::
Human   232 LNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQ---ESWYK 293

  Fly   163 AECIKRLPTIRKLDGEPVVLNE 184
            ...::.:..:|:||.:.:...|
Human   294 HTVLQNMMQLRQLDMKRITEEE 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 52/216 (24%)
leucine-rich repeat 50..71 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
LRRC49NP_001185946.1 LRR_8 118..173 CDD:290566 18/56 (32%)
LRR_4 118..158 CDD:289563 11/41 (27%)
LRR 1 118..139 5/22 (23%)
leucine-rich repeat 119..140 CDD:275380 5/22 (23%)
LRR_4 139..181 CDD:289563 19/42 (45%)
LRR 2 140..161 7/21 (33%)
leucine-rich repeat 141..162 CDD:275380 7/21 (33%)
LRR 3 162..183 12/21 (57%)
LRR_4 163..203 CDD:289563 11/40 (28%)
leucine-rich repeat 163..184 CDD:275380 11/21 (52%)
LRR 4 184..205 0/21 (0%)
leucine-rich repeat 185..206 CDD:275380 0/21 (0%)
LRR_4 205..247 CDD:289563 6/42 (14%)
LRR_8 206..261 CDD:290566 12/55 (22%)
LRR 5 206..227 0/21 (0%)
leucine-rich repeat 207..228 CDD:275380 0/21 (0%)
LRR_4 228..268 CDD:289563 13/40 (33%)
LRR 6 228..249 7/21 (33%)
leucine-rich repeat 229..250 CDD:275380 7/21 (33%)
LRR 7 250..271 7/21 (33%)
leucine-rich repeat 251..275 CDD:275380 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.