DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc6

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_062330.1 Gene:Lrrc6 MGIID:1859553 Length:473 Species:Mus musculus

Alignment Length:138 Identity:40/139 (29%)
Similarity:70/139 (50%) Gaps:5/139 (4%)


  Fly    51 ERISMSTNMIEKIFGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGL 114
            |.:|:....||::..: ...:.||:|.|..|.|.:|..:..: :.||.|.|:.|.||:|:.|.|.
Mouse    24 EELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKL-KKLEYLNLALNNIERIENLEGC 87

  Fly   115 KCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEP 179
            :.|..|.::.|.|.:.|....|.....|::|.::|||.:   |...:|...:..|..::.|||:.
Mouse    88 EWLTKLDLTVNFIGELSSVKTLTHNIHLKELFLMGNPCA---DFDGYRQFVVVTLQQLKWLDGKE 149

  Fly   180 VVLNEEPQ 187
            :..:|..|
Mouse   150 IERSERIQ 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 38/134 (28%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 10/21 (48%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
Lrrc6NP_062330.1 LRR_4 22..64 CDD:289563 11/40 (28%)
LRR 1 22..43 4/19 (21%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR 2 45..66 7/22 (32%)
LRR_8 46..98 CDD:290566 19/53 (36%)
LRR_4 46..86 CDD:289563 16/41 (39%)
leucine-rich repeat 46..67 CDD:275378 7/22 (32%)
LRR 3 67..88 10/21 (48%)
leucine-rich repeat 68..89 CDD:275378 10/21 (48%)
LRR 4 89..110 6/21 (29%)
leucine-rich repeat 90..114 CDD:275378 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.