DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrriq3

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001019478.1 Gene:Lrriq3 RGDID:1591943 Length:633 Species:Rattus norvegicus

Alignment Length:192 Identity:46/193 (24%)
Similarity:74/193 (38%) Gaps:41/193 (21%)


  Fly     1 MSKATTIKEALKRWEE---REQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEK 62
            ::|..|..|....:.|   .:|::.:..|...|..:  .:|.:.|.:...| |   ..|.|.:..
  Rat     6 ITKELTSHEEWSHYNENIVEDQKDFVFVKYNGLHLK--SMENLQSCISLRV-C---IFSNNFVTD 64

  Fly    63 IFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEE--LWLSYNLIEKIKGLTGLKCLKVLYISNN 125
            |..|.|.|.|..|.|..|.||          ||.:  .|            .|||.||:||:.:|
  Rat    65 IQPLQGCKKLIKLDLHGNQIK----------TLPDRTFW------------NGLKNLKLLYLHDN 107

  Fly   126 LIKDWSEFNRLAEIESLEDLVVVGNPLS--EGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
            ..........|:...:|..|.:...|:|  :|     :|...:..:..::.|| ..|:.:||
  Rat   108 GFAKLKNICVLSGCVNLVGLTMFDCPVSLKKG-----YRHVLVNSIWPLKALD-HHVISDEE 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 41/177 (23%)
leucine-rich repeat 50..71 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 5/23 (22%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
Lrriq3NP_001019478.1 LRR_8 51..109 CDD:290566 25/84 (30%)
LRR_4 51..89 CDD:289563 16/52 (31%)
LRR 1 51..72 7/25 (28%)
leucine-rich repeat 52..73 CDD:275380 8/25 (32%)
LRR_4 72..115 CDD:289563 18/65 (28%)
LRR 2 73..94 9/43 (21%)
leucine-rich repeat 74..98 CDD:275380 12/46 (26%)
LRR 3 98..119 6/21 (29%)
leucine-rich repeat 99..123 CDD:275380 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.