DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and lrrc23

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001006054.1 Gene:lrrc23 ZFINID:ZDB-GENE-041010-153 Length:326 Species:Danio rerio

Alignment Length:210 Identity:54/211 (26%)
Similarity:90/211 (43%) Gaps:62/211 (29%)


  Fly    31 QFQWPPIEKMDSTL---------GTLVQCERISMSTNMIEKIFGLSGM----------------- 69
            |..|   .|.||.|         |.|...:.:|:::|.:..:.||.|.                 
Zfish   105 QLLW---VKGDSNLLQGFEGQPFGQLTFLQWLSIASNRLFDVTGLGGPALETLNLTGNGIQTMQG 166

  Fly    70 ----------------KCLKV-----------LSLSRNYIKQISGLEAVAETLEELWLSYNLIEK 107
                            .||:.           |.|::|.||::.|||.: |.|..|.|.:|.:|.
Zfish   167 LDHPNLTNLVTLELRGNCLETTDGIYLPNLRHLYLAQNNIKKLEGLEKL-ERLITLHLRHNQLET 230

  Fly   108 IKGLT-GLKCLKVLYISNNLIKDWSEFNRLAEI-ESLEDLVVVGNPLSEGLDEPTWRAECIKRLP 170
            :.||: .:|||:.|.:..|||........||.: ::|:.||::.||:::..|   :|...|.:||
Zfish   231 LDGLSASMKCLEYLNVRGNLISSMRALQTLASVGQTLKALVLLDNPIAKTDD---YRLYVISQLP 292

  Fly   171 TIRKLDGEPVVLNEE 185
            .:.::|.:||...|:
Zfish   293 HLERVDKDPVTPEEK 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 53/208 (25%)
leucine-rich repeat 50..71 CDD:275380 5/54 (9%)
leucine-rich repeat 95..116 CDD:275380 8/22 (36%)
leucine-rich repeat 117..141 CDD:275380 7/25 (28%)
lrrc23NP_001006054.1 leucine-rich repeat 64..83 CDD:275380
LRR_4 65..102 CDD:289563
LRR_8 83..140 CDD:290566 10/38 (26%)
leucine-rich repeat 84..105 CDD:275380 54/211 (26%)
leucine-rich repeat 106..129 CDD:275380 7/26 (27%)
leucine-rich repeat 130..150 CDD:275380 5/20 (25%)
LRR_8 149..206 CDD:290566 5/57 (9%)
leucine-rich repeat 151..174 CDD:275380 0/23 (0%)
leucine-rich repeat 175..195 CDD:275380 2/20 (10%)
LRR_8 194..251 CDD:290566 22/58 (38%)
LRR_4 194..235 CDD:289563 16/42 (38%)
leucine-rich repeat 196..217 CDD:275380 9/22 (41%)
LRR_4 216..258 CDD:289563 15/42 (36%)
leucine-rich repeat 218..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..262 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.