DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and dnal1

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001003442.1 Gene:dnal1 ZFINID:ZDB-GENE-040801-178 Length:192 Species:Danio rerio

Alignment Length:186 Identity:110/187 (59%)
Similarity:140/187 (75%) Gaps:1/187 (1%)


  Fly     1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFG 65
            |:|||||||||.:|||:..:.:..|..:.|..|.|||||||::|..||.|||:|:|||.||||..
Zfish     1 MAKATTIKEALVKWEEKTGEKANDATAVKLYGQIPPIEKMDASLSNLVNCERLSLSTNCIEKIAN 65

  Fly    66 LSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDW 130
            |:|:|.||:|||.||.||.::|||||.:||||||:|||||||:||:..:|.|||||:||||:|:|
Zfish    66 LNGLKNLKILSLGRNNIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKEW 130

  Fly   131 SEFNRLAEIESLEDLVVVGNPLSEGLD-EPTWRAECIKRLPTIRKLDGEPVVLNEE 185
            .||.:||::.||.|||.|||||.|... :..|..|..||||.::||||.||:..||
Zfish   131 GEFLKLADLPSLVDLVFVGNPLEEKYSADGNWIEEATKRLPKLKKLDGNPVIKQEE 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 98/171 (57%)
leucine-rich repeat 50..71 CDD:275380 14/21 (67%)
leucine-rich repeat 95..116 CDD:275380 15/21 (71%)
leucine-rich repeat 117..141 CDD:275380 15/24 (63%)
dnal1NP_001003442.1 LRR_4 49..89 CDD:289563 25/40 (63%)
LRR 1 49..70 13/21 (62%)
leucine-rich repeat 50..71 CDD:275380 14/21 (67%)
LRR_8 70..127 CDD:290566 40/57 (70%)
LRR 2 71..92 14/21 (67%)
leucine-rich repeat 72..94 CDD:275380 14/22 (64%)
LRR 3 94..115 15/21 (71%)
LRR_4 95..133 CDD:289563 27/38 (71%)
leucine-rich repeat 95..116 CDD:275380 15/21 (71%)
LRR 4 116..137 14/21 (67%)
leucine-rich repeat 117..141 CDD:275380 15/24 (63%)
leucine-rich repeat 142..172 CDD:275380 16/30 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158732623
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 1 1.000
Homologene 1 1.000 H34623
Inparanoid 1 1.050 218 1.000 Inparanoid score I3504
OMA 1 1.010
OrthoDB 1 1.010 D1395642at2759
OrthoFinder 1 1.000 FOG0007569
OrthoInspector 1 1.000 T595916
orthoMCL 1 0.900 OOG5_129790
Panther 1 1.100 LDO PTHR15454
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4855
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.