DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and CG9044

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001260114.1 Gene:CG9044 FlyBaseID:FBgn0031752 Length:1318 Species:Drosophila melanogaster

Alignment Length:194 Identity:44/195 (23%)
Similarity:84/195 (43%) Gaps:23/195 (12%)


  Fly     5 TTIKEALKR----------WEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNM 59
            |::.:.:.|          |.|        .|..|  |.:..:..:|:.|......:.:::..|.
  Fly   146 TSVDDIITRCGGDNSNGFVWNE--------LKTAD--FSYNSLRSVDTALEFAQHLQHLNLRHNK 200

  Fly    60 IEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVA-ETLEELWLSYNLIEKIKGLTGLKCLKVLYIS 123
            :..:..:..:..||.|.||.|.:..:......| :.|:.|.:|.|.:|::..:..|..|..|.:|
  Fly   201 LTSVAAIKWLPHLKTLDLSYNCLTHLPQFHMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLS 265

  Fly   124 NNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECI-KRLPTIR-KLDGEPVVLNEE 185
            :|.:.:.|:...|:.:.||..|.:.||||:.........|:.: |...|:: .||.||:...|:
  Fly   266 DNCLLEHSQLLPLSALMSLIVLNLQGNPLACNPKHRQATAQYLHKNSATVKFVLDFEPLTKAEK 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 41/173 (24%)
leucine-rich repeat 50..71 CDD:275380 1/21 (5%)
leucine-rich repeat 95..116 CDD:275380 6/21 (29%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
CG9044NP_001260114.1 LIP1 6..96 CDD:292526
LRR_RI <102..302 CDD:238064 36/166 (22%)
leucine-rich repeat 168..190 CDD:275380 5/24 (21%)
LRR_4 189..229 CDD:289563 7/40 (18%)
LRR_8 190..245 CDD:290566 11/55 (20%)
leucine-rich repeat 191..212 CDD:275380 1/21 (5%)
leucine-rich repeat 213..236 CDD:275380 7/23 (30%)
leucine-rich repeat 237..258 CDD:275380 6/21 (29%)
leucine-rich repeat 259..283 CDD:275380 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR15454
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.