DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc23

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001013183.2 Gene:Lrrc23 RGDID:1304779 Length:345 Species:Rattus norvegicus

Alignment Length:133 Identity:41/134 (31%)
Similarity:72/134 (54%) Gaps:6/134 (4%)


  Fly    47 LVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGL 111
            |.....:.:..|.:|...|::..| ||.|.|::|.:|::.|||.:: .|..|.|..|.||.:.|.
  Rat   180 LTNLHTLELRANQLETTIGINLPK-LKNLYLAQNLLKKVEGLENLS-NLTTLHLRDNQIETLDGF 242

  Fly   112 T-GLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKL 175
            : .:|.|:.|.:.:|:|.|..|..:|.::..|..||::.||.:   ||..:|.|.:.::..:.:|
  Rat   243 SKEMKSLQYLNLRSNMISDLGELAKLRDLPKLRALVLLDNPCA---DETDYRQEALVQMAHLERL 304

  Fly   176 DGE 178
            |.|
  Rat   305 DKE 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 41/134 (31%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 8/22 (36%)
leucine-rich repeat 117..141 CDD:275380 7/24 (29%)
Lrrc23NP_001013183.2 leucine-rich repeat 75..94 CDD:275380
leucine-rich repeat 95..116 CDD:275380
leucine-rich repeat 117..137 CDD:275380
leucine-rich repeat 138..158 CDD:275380
leucine-rich repeat 159..182 CDD:275380 1/2 (50%)
leucine-rich repeat 183..203 CDD:275380 3/20 (15%)
LRR_8 202..259 CDD:290566 21/59 (36%)
LRR_4 202..244 CDD:289563 17/44 (39%)
leucine-rich repeat 204..225 CDD:275380 9/22 (41%)
LRR_4 225..267 CDD:289563 14/42 (33%)
leucine-rich repeat 226..248 CDD:275380 8/22 (36%)
leucine-rich repeat 249..273 CDD:275380 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.