DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc49

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006243264.1 Gene:Lrrc49 RGDID:1309466 Length:752 Species:Rattus norvegicus

Alignment Length:217 Identity:55/218 (25%)
Similarity:94/218 (43%) Gaps:54/218 (25%)


  Fly    18 EQQNSLTAKVID-------LQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVL 75
            |:|......:||       |.||...|.::.: :..|.:...:.:..|.||:|.|||.:|.|:||
  Rat   164 ERQKLTVCPIIDGEEHLRLLNFQHNFITRIQN-ISNLQRLIFLDLYDNQIEEISGLSTLKSLRVL 227

  Fly    76 SLSRNYIKQISGLEAV-------------------------------------------AETLEE 97
            .|.:|.||:||.||.:                                           .::|.|
  Rat   228 LLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTE 292

  Fly    98 LWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWR 162
            |.|.:|.|..::.:..|.||:.|::|.|.|..:...:.|||..||.|:...|||:::   |..::
  Rat   293 LNLRHNQITFVRDVDNLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQ---ESWYK 354

  Fly   163 AECIKRLPTIRKLDGEPVVLNE 184
            ...::.:..:|:||.:.:...|
  Rat   355 HTVLQNMMQLRQLDMKRITEEE 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 54/216 (25%)
leucine-rich repeat 50..71 CDD:275380 8/21 (38%)
leucine-rich repeat 95..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..141 CDD:275380 8/24 (33%)
Lrrc49XP_006243264.1 leucine-rich repeat 160..177 CDD:275380 4/13 (31%)
LRR_4 178..219 CDD:289563 11/42 (26%)
leucine-rich repeat 180..201 CDD:275380 5/22 (23%)
LRR_4 200..242 CDD:289563 19/42 (45%)
leucine-rich repeat 202..223 CDD:275380 8/21 (38%)
LRR_8 222..278 CDD:290566 12/56 (21%)
LRR_4 222..264 CDD:289563 12/42 (29%)
leucine-rich repeat 224..245 CDD:275380 11/21 (52%)
LRR_4 244..286 CDD:289563 0/42 (0%)
leucine-rich repeat 246..267 CDD:275380 0/21 (0%)
LRR_8 268..322 CDD:290566 12/54 (22%)
leucine-rich repeat 268..289 CDD:275380 0/21 (0%)
LRR_4 289..329 CDD:289563 13/40 (33%)
leucine-rich repeat 290..311 CDD:275380 7/21 (33%)
leucine-rich repeat 312..336 CDD:275380 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.