DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8800 and Lrrc46

Sequence 1:NP_610483.1 Gene:CG8800 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001004201.1 Gene:Lrrc46 RGDID:1303311 Length:323 Species:Rattus norvegicus

Alignment Length:186 Identity:52/187 (28%)
Similarity:85/187 (45%) Gaps:29/187 (16%)


  Fly     8 KEALKRWEEREQQNSLTAKVI-----------DLQFQWPPIEKMDSTLGTLVQCERISMSTNMIE 61
            :||....::.|:...:|..:|           ||.      |||..||..|   |.:.:....|.
  Rat     6 QEAKNATQKTEEGVHITEALITKRNLTFPEDEDLS------EKMFHTLDDL---ETVRLDGEGIT 61

  Fly    62 KIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNL 126
            .|..|..::.:..|.|..|.|::|..|..:. :|..|.|:.|.|..::.|..|:.|:.|.:|.||
  Rat    62 CIGNLERLRNIHSLYLQSNKIQRIENLACIT-SLRFLSLAGNQIRHVENLLDLQYLQFLDLSENL 125

  Fly   127 IKDWSEFNRLAEI-ESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVV 181
            |    |..:|.|: :||..|.:.|||.:   ::..:|...|..||.:..||.:|::
  Rat   126 I----ETLKLDELPQSLLILNLCGNPCT---NQDGYRKMVIGALPLLLDLDKQPIL 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 LRR_9 14..184 CDD:317038 50/181 (28%)
leucine-rich repeat 50..71 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 7/21 (33%)
leucine-rich repeat 117..141 CDD:275380 9/25 (36%)
Lrrc46NP_001004201.1 LRR 1 49..70 5/24 (21%)
LRR_4 50..89 CDD:289563 11/42 (26%)
leucine-rich repeat 50..71 CDD:275378 5/24 (21%)
LRR_8 70..126 CDD:290566 18/57 (32%)
LRR_4 71..110 CDD:289563 11/40 (28%)
LRR 2 71..92 6/21 (29%)
leucine-rich repeat 72..93 CDD:275378 6/22 (27%)
LRR_4 92..130 CDD:289563 14/43 (33%)
LRR 3 93..114 7/21 (33%)
leucine-rich repeat 94..115 CDD:275378 7/21 (33%)
LRR 4 115..135 9/24 (38%)
leucine-rich repeat 116..137 CDD:275378 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.